Recombinant Sulfolobus tokodaii Protease HtpX homolog 1 (htpX1)

Shipped with Ice Packs
In Stock

Description

Taxonomic Context of Sulfolobus tokodaii

Sulfolobus tokodaii is a hyperthermophilic archaeon that belongs to the phylum Crenarchaeota. This microorganism is naturally found in acidic hot springs and thrives under extreme environmental conditions, including high temperatures and low pH levels. S. tokodaii strain 7 (DSM 16993 / JCM 10545 / NBRC 100140) has been fully sequenced and serves as a model organism for studying archaeal biology and extremophilic adaptations . The genus Sulfolobus has gained significant attention in biotechnology due to the inherent stability of its proteins, which can withstand harsh conditions that would denature most mesophilic proteins . These thermostable proteins, including various proteases and esterases, offer considerable potential for industrial applications requiring enzymatic activity under extreme conditions .

Classification of Protease HtpX homolog 1

Protease HtpX homolog 1 (htpX1) is classified as a membrane-bound zinc metalloprotease that belongs to the M48 peptidase family. The protein is encoded by the htpX1 gene, also known by its locus tag STK_08360 in the S. tokodaii genome . HtpX proteases are generally involved in protein quality control systems, particularly in stress response mechanisms. In Sulfolobus tokodaii, two homologs of HtpX have been identified – htpX1 and htpX2 – suggesting potentially specialized functions or regulatory mechanisms within this archaeon . The recombinant form of htpX1 typically includes a histidine tag to facilitate purification and characterization studies .

Recombinant Expression in Escherichia coli

The production of recombinant Sulfolobus tokodaii Protease HtpX homolog 1 primarily utilizes Escherichia coli as the expression host. This heterologous expression system allows for efficient production of the archaeal protein in a well-established bacterial system . The full-length protein, encompassing amino acids 1-311, is expressed with an N-terminal histidine tag to facilitate downstream purification processes. The expression in E. coli represents a significant biotechnological achievement, considering the substantial differences between bacterial and archaeal cellular machinery .

Successful expression in E. coli suggests that despite its archaeal origin, the htpX1 protein can fold properly in a bacterial environment, although specific optimization of expression conditions may be required to maximize yield and activity. The product information indicates that the commercial preparation contains the correctly folded and functional protein, suitable for various research applications .

Purification and Protein Tagging

The recombinant htpX1 protein is purified using affinity chromatography, leveraging the N-terminal histidine tag that has high affinity for metal ions such as nickel or cobalt . This purification strategy allows for selective isolation of the target protein from the complex mixture of host cell proteins. The final product achieves a purity greater than 90% as determined by SDS-PAGE analysis .

The histidine tag not only facilitates purification but also provides a consistent attachment point for potential immobilization applications or detection methods. The commercial preparation of the protein is supplied as a lyophilized powder, which enhances stability during storage and shipping . The fusion of the histidine tag to the N-terminus appears not to interfere with the protein's structural integrity or function, making it suitable for various biochemical and functional studies.

Enzymatic Activity

While the specific enzymatic parameters of Sulfolobus tokodaii htpX1 are not explicitly detailed in the provided search results, inferences can be made based on homologous proteases from the same genus. HtpX proteases typically function as endopeptidases that cleave peptide bonds within misfolded or damaged proteins, particularly those embedded in membranes . This proteolytic activity is often integral to protein quality control systems that maintain cellular proteostasis under stress conditions.

The Sulfolobus genus is known for producing various proteases with considerable stability and activity at high temperatures, with some exhibiting optimal function at temperatures approaching 90-100°C . These thermostable proteases have garnered significant interest for biotechnological applications. Based on this genus-level characteristic, it is reasonable to hypothesize that Sulfolobus tokodaii htpX1 likely possesses similar thermostable properties, though specific activity measurements would be necessary to confirm this .

Stability and Optimal Conditions

The thermostability of proteins from Sulfolobus species is well-documented, and htpX1 is expected to demonstrate remarkable stability at elevated temperatures typical of its native environment . Although the specific temperature optimum for htpX1 is not explicitly stated in the search results, proteases from related Sulfolobus species exhibit optimal activity at temperatures ranging from 70°C to 94°C, with some maintaining stability for extended periods at 90°C .

For comparison, an esterase from Sulfolobus tokodaii strain 7 demonstrates optimal activity at 70°C and remains active in mixtures of water and organic solvents such as acetonitrile and dimethyl sulfoxide, suggesting that enzymes from this organism generally possess considerable stability against denaturants beyond just temperature . Given these observations, htpX1 is likely to exhibit similar resistance to denaturation by heat, pH extremes, and potentially certain organic solvents or denaturants.

Comparison with HtpX Homologs

Sulfolobus tokodaii contains at least two homologs of the HtpX protease, designated as htpX1 and htpX2 . While htpX1 consists of 311 amino acids, htpX2 comprises 325 amino acids and is encoded by locus tag STK_23460 . Both proteins are classified as membrane-bound metalloproteases and likely share similar catalytic mechanisms, but their sequence differences suggest potential specialization in substrate specificity or regulatory contexts.

The amino acid sequence of htpX2 begins with "MIWEVTKLRISMILSAIAILVLGFALIYGILGYFFGFSNAPLLITGALAFVTIFTILQWL..." , which differs notably from the htpX1 sequence. These differences may translate to distinct structural features, membrane topology, or functional properties between the two homologs. The presence of multiple HtpX homologs in a single organism suggests potential complementary roles in protein quality control mechanisms or adaptation to different stress conditions.

Evolutionary Significance

While not specifically detailed in the search results, the conservation of HtpX proteases across diverse organisms from bacteria to archaea indicates their fundamental importance in cellular processes. The presence of HtpX homologs in extremophiles like Sulfolobus tokodaii is particularly significant, as these proteins likely play crucial roles in maintaining protein homeostasis under extreme environmental conditions.

For comparison, information about htpX1 from Haloarcula marismortui, another archaeon but from a different phylogenetic lineage, is available . This htpX1 protein (Gene ID: 12906) consists of 293 amino acids, slightly shorter than the Sulfolobus tokodaii counterpart . The amino acid sequence shows distinct differences while maintaining the core functional domains characteristic of HtpX proteases. This evolutionary divergence reflects adaptation to different extreme environments – high temperature for Sulfolobus versus high salinity for Haloarcula – while preserving the essential proteolytic function.

Biotechnological Applications

The exceptional stability of Sulfolobus-derived enzymes makes htpX1 a promising candidate for various biotechnological applications. Thermostable proteases have numerous industrial applications, including in detergent formulations, leather processing, food industry, and bioremediation processes . The ability to function at high temperatures offers advantages such as higher reaction rates, reduced risk of microbial contamination, and improved substrate solubility.

Additionally, archaeal enzymes often demonstrate tolerance to organic solvents, detergents, and extreme pH conditions, further expanding their potential applications in non-conventional reaction media . While the specific industrial applicability of htpX1 requires further characterization, the general properties of Sulfolobus-derived proteases suggest significant potential for processes requiring robust proteolytic activity under harsh conditions.

Research Opportunities

Several research directions could further elucidate the structure, function, and applications of Sulfolobus tokodaii htpX1:

  1. Detailed biochemical characterization to determine optimal reaction conditions, substrate specificity, and kinetic parameters.

  2. Structural studies using X-ray crystallography or cryo-electron microscopy to resolve the three-dimensional structure and catalytic mechanism.

  3. Comparative functional analysis of htpX1 and htpX2 to understand their potentially distinct roles in Sulfolobus tokodaii.

  4. Protein engineering to enhance specific properties such as catalytic efficiency, substrate range, or stability in industrial solvents.

  5. Investigation of potential applications in biotechnological processes, particularly those requiring proteolytic activity under extreme conditions.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific requests. Please indicate your preferred format during order placement, and we will do our best to fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please let us know, and we will prioritize developing the specified tag.
Synonyms
htpX1; STK_08360; Protease HtpX homolog 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Target Names
htpX1
Target Protein Sequence
MEIGTSLKINMIIALFLTIVSEGIFSLVIINFLKFPVIFSIIFLLILWLIQWLISPYLVE RNSVEVTRDDPSYGWVYELVENVARRAGIKTPRVFLVDEPYPNAFAYGNYVTGKRIGITI PLLQILTTEELESVIGHELGHIKHNDVEIGLAIGLIPSILGFISNILLTVGWATLIFAVD EFDILVGLTMLAIGGVLFVITFFLQLFVLWFNRLRESFADYFSYELFRERAWNLAKALAK IEIYMQNIRLDPFRGIIVTIPPTKVKESDPDLLIEDLLREKTNIFSDILSTHPHPAKRIK MIYKLTKPMIF
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Sulfolobus tokodaii Protease HtpX homolog 1 (htpX1) and what is its biological function?

Sulfolobus tokodaii Protease HtpX homolog 1 (htpX1) is a metalloprotease encoded by the htpX1 gene (STK_08360) in the extremophilic archaeon Sulfolobus tokodaii. This organism is a thermoacidophilic archaeon that thrives in high-temperature, acidic environments. The protease belongs to the HtpX family of proteases, which generally function in protein quality control pathways. In its native context, htpX1 likely plays a role in degrading misfolded or damaged membrane proteins, similar to its homologs in other organisms. The protein consists of 311 amino acid residues and has the UniProt accession number Q973R2 . The functional characterization suggests it has metalloprotease activity (EC 3.4.24.-), utilizing metal ions, typically zinc, in its catalytic mechanism .

What are the optimal storage conditions for Recombinant Sulfolobus tokodaii Protease HtpX homolog 1?

For optimal preservation of enzymatic activity, Recombinant Sulfolobus tokodaii Protease HtpX homolog 1 should be stored in a Tris-based buffer containing 50% glycerol, which has been optimized specifically for this protein's stability . The recommended storage temperature is -20°C for regular use, or -80°C for extended storage periods to minimize activity loss . It is critical to avoid repeated freeze-thaw cycles as they can significantly compromise protein integrity and enzymatic function. For ongoing experiments, working aliquots can be maintained at 4°C for up to one week without significant activity loss . To minimize degradation during storage, the following protocol is recommended:

Storage DurationTemperatureBuffer CompositionAdditional Recommendations
Short-term (≤1 week)4°CTris-based buffer with 50% glycerolKeep sealed to prevent contamination
Medium-term (≤6 months)-20°CTris-based buffer with 50% glycerolPrepare small working aliquots
Long-term (>6 months)-80°CTris-based buffer with 50% glycerolFlash-freeze in liquid nitrogen

What are the recommended protocols for reconstituting lyophilized Recombinant Sulfolobus tokodaii Protease HtpX homolog 1?

When reconstituting lyophilized Recombinant Sulfolobus tokodaii Protease HtpX homolog 1, researchers should follow a methodical approach to ensure maximum activity retention. The reconstitution protocol should account for the protein's membrane-associated nature and thermostability properties. Begin by equilibrating the lyophilized protein to room temperature (approximately 22-25°C) before opening the container to prevent moisture condensation. Reconstitute in a Tris-based buffer (typically 50 mM Tris-HCl, pH 8.0) containing 150 mM NaCl and potentially low concentrations (0.01-0.05%) of a mild detergent such as n-dodecyl β-D-maltoside (DDM) to maintain solubility of this membrane-associated protein.

For long-term storage, add glycerol to a final concentration of 50% after reconstitution . The reconstitution process should be gentle, avoiding vigorous vortexing which can lead to protein denaturation. Instead, use slow rotation or gentle inversion to dissolve the protein completely. After reconstitution, centrifuge briefly (5,000 × g for 2 minutes) to collect all liquid and remove any particulates. Aliquot the reconstituted protein into appropriate volumes for single-use experiments to avoid freeze-thaw cycles. Activity assays should be performed immediately after reconstitution to establish a baseline for subsequent experimental comparisons.

How can researchers optimize enzymatic activity assays for htpX1?

Optimizing enzymatic activity assays for htpX1 requires careful consideration of its metalloprotease nature and thermophilic origin. The assay design should incorporate the following methodological elements:

  • Buffer Composition: Use a temperature-stable buffer such as HEPES or PIPES (50-100 mM) with pH 7.0-8.0, which remains effective at elevated temperatures that mimic S. tokodaii's natural environment.

  • Temperature Conditions: Conduct assays at multiple temperatures (37°C, 60°C, 80°C) to determine optimal activity, as S. tokodaii is a thermophile that naturally grows at temperatures around 80°C.

  • Metal Cofactors: Supplement assays with ZnCl₂ (typically 0.1-1 mM) as htpX1 is a metalloprotease that likely requires zinc for catalytic activity. Additionally, test other divalent metals (Mg²⁺, Ca²⁺, Mn²⁺) to identify potential cofactor preferences.

  • Substrate Selection: Use fluorogenic peptide substrates containing recognition sites for metalloproteases. Common substrates include FRET-based peptides that emit fluorescence upon cleavage. For more specific activity assessment, design custom peptides based on predicted substrate sequences from membrane proteins.

  • Assay Monitoring: Track activity using continuous fluorescence measurements (for fluorogenic substrates) or HPLC analysis of cleavage products for unlabeled peptides. Establish reaction kinetics by measuring initial velocity at various substrate concentrations.

  • Controls and Inhibitors: Include negative controls (heat-inactivated enzyme) and positive controls (commercial metalloproteases). Test metalloprotease inhibitors like EDTA, 1,10-phenanthroline, or bestatin to confirm the catalytic mechanism.

The following table outlines recommended assay conditions for initial characterization:

ParameterRecommended RangeMeasurement Method
pH6.0-9.0 (0.5 increments)Activity at each pH using consistent buffer systems
Temperature30-90°C (10°C increments)Activity measurement at each temperature point
Divalent MetalsZn²⁺, Mg²⁺, Ca²⁺, Mn²⁺, Ni²⁺ (0.1-1 mM)Activity with each metal cofactor
Substrate Concentration1-100 μMMichaelis-Menten kinetics analysis
Enzyme Concentration10-100 nMLinear response verification

After initial optimization, researchers should verify the specificity of htpX1 activity using protein substrates that mimic its natural targets, such as misfolded membrane proteins or synthetic peptides derived from them.

What techniques are most effective for studying htpX1 substrate specificity?

To effectively characterize htpX1 substrate specificity, researchers should employ a multi-faceted approach combining computational prediction, peptide library screening, and validation with native-like substrates.

Computational Prediction Approach:
Begin with in silico analysis of potential cleavage sites using sequence motif analysis based on known metalloprotease preferences. Homology modeling of htpX1 against structurally characterized HtpX family proteins can provide insights into the active site architecture and substrate binding pocket. Molecular docking simulations can then predict interactions with potential substrate peptides.

Peptide Library Screening:
Utilize positional scanning synthetic combinatorial libraries (PS-SCL) consisting of fluorogenic peptides with systematic amino acid substitutions at positions P4-P4' around the potential cleavage site. This approach can comprehensively map amino acid preferences at each position. Alternatively, employ PICS (Proteomic Identification of protease Cleavage Sites) methodology, where a proteome-derived peptide library is incubated with htpX1, and cleavage products are identified by mass spectrometry.

Validation with Native-like Substrates:
Following initial screening, validate findings using longer peptides or full-length proteins that represent physiologically relevant substrates. For htpX1, these would likely include:

  • Membrane proteins from thermophilic organisms

  • Artificially misfolded membrane proteins (created through site-directed mutagenesis)

  • Heat-denatured proteins that mimic stress conditions

Methodological Protocol:

  • Express and purify potential substrate proteins with appropriate tags for detection.

  • Reconstitute substrates in detergent micelles or nanodiscs to mimic membrane environment.

  • Incubate with active htpX1 under optimized conditions (temperature, pH, cofactors).

  • Analyze cleavage products using a combination of SDS-PAGE, western blotting, and mass spectrometry.

  • Map cleavage sites precisely using N-terminal sequencing or MS/MS analysis.

Data Analysis:
Compile cleavage site data to generate a consensus sequence logo representing preferred amino acids at each position. Compare this profile with other HtpX family proteases to identify conserved and unique features of htpX1 specificity.

The following table provides a framework for systematic substrate specificity analysis:

Analysis LevelTechniquesExpected Outcomes
Primary Sequence PreferencesPeptide library screening, LC-MS/MSConsensus motif for cleavage sites
Structural RequirementsCircular dichroism, NMR with substrate variantsSecondary structure requirements around cleavage sites
Membrane Context InfluenceReconstitution in nanodiscs vs. detergent micellesEffect of lipid environment on substrate recognition
Thermostability FactorsActivity assays at various temperatures with different substratesCorrelation between substrate stability and cleavage efficiency

By systematically applying these techniques, researchers can develop a comprehensive profile of htpX1 substrate specificity that accounts for both sequence and structural determinants of recognition and cleavage.

How does Sulfolobus tokodaii Protease HtpX homolog 1 compare to HtpX proteases from other organisms?

Sulfolobus tokodaii Protease HtpX homolog 1 (htpX1) shares functional similarities with other HtpX family proteases while exhibiting distinct adaptations reflective of its archaeal thermophilic origin. Comparative analysis reveals several key differences and similarities:

Functional Role:
While bacterial HtpX proteases primarily function in protein quality control during stress responses (particularly heat shock), archaeal homologs like htpX1 may have evolved more specialized roles. The presence of htpX1 in S. tokodaii, which naturally grows at temperatures around 80°C, suggests it may be constitutively active rather than stress-induced as in mesophilic bacteria.

Substrate Specificity:
Bacterial HtpX proteases typically recognize misfolded membrane proteins, particularly those with exposed hydrophobic regions. The substrate specificity of htpX1 likely reflects adaptations to the unique archaeal membrane composition of S. tokodaii, which contains tetraether lipids rather than the phospholipid bilayers found in bacteria.

Comparative Sequence Analysis:
The following table compares key features of htpX1 with homologs from other domains:

OrganismDomainGrowth TemperatureSequence Identity to htpX1Key Adaptive Features
Sulfolobus tokodaiiArchaea75-80°C100% (reference)High proportion of charged residues, multiple transmembrane domains
Escherichia coliBacteria37°C~30-35%Fewer charged residues, stress-inducible expression
Thermococcus kodakarensisArchaea60-100°C~45-50%Similar thermostable adaptations, different membrane composition
Homo sapiens (HTPX homolog)Eukarya37°C~25-30%Additional regulatory domains, compartmentalized localization

This evolutionary divergence highlights the specialized adaptation of htpX1 to the extreme environment of S. tokodaii, making it a valuable model for studying protease evolution and adaptation to extreme conditions.

What is the evolutionary significance of htpX1 in the context of archaeal proteases?

The evolutionary significance of htpX1 in Sulfolobus tokodaii extends beyond its functional role, offering insights into archaeal protein quality control systems and the evolution of proteases in extremophiles. As part of the Crenarchaeota phylum within the archaeal domain, S. tokodaii represents an important evolutionary lineage distinct from both bacteria and eukarya .

The archaeal domain is fundamentally divided into established phyla, including Crenarchaeota and Euryarchaeota, based on significant differences in cellular processes including translation, transcription, and DNA replication mechanisms . Within this context, proteases like htpX1 serve as molecular markers that can help trace evolutionary relationships and adaptations.

Horizontal Gene Transfer vs. Vertical Inheritance:
Phylogenetic analysis of HtpX family proteases suggests that while the core catalytic function has been vertically inherited from a common ancestor, horizontal gene transfer events may have contributed to the distribution and diversification of these proteases across different lineages. The S. tokodaii genome, comprising a circular chromosome of 1,590,757 bp with a G+C content of 49% , contains several genes potentially acquired through horizontal transfer, particularly those involved in adaptation to extreme environments.

Genomic Context and Co-evolution:
The genomic organization surrounding the htpX1 gene (STK_08360) provides insights into its co-evolution with other cellular systems. In many organisms, HtpX proteases genomically cluster with genes involved in membrane protein biosynthesis and quality control, suggesting coordinated evolution of these systems. The evolutionary trajectory of htpX1 appears to have been influenced by the unique membrane composition of S. tokodaii, which differs significantly from bacterial membranes in lipid composition and structure.

Implications for Understanding Early Life:
The study of archaeal proteases like htpX1 contributes to our understanding of early life on Earth, particularly in extreme environments that may resemble primordial conditions. Thermophilic archaea like S. tokodaii may preserve ancient protein quality control mechanisms that were essential for survival in the harsh conditions of early Earth. The retention and adaptation of htpX1 in modern extremophiles demonstrate the evolutionary importance of protein quality control systems across billions of years of evolution.

How can Sulfolobus tokodaii Protease HtpX homolog 1 be leveraged for structural biology studies?

Leveraging Sulfolobus tokodaii Protease HtpX homolog 1 (htpX1) for structural biology studies presents both challenges and unique opportunities due to its membrane-associated nature and thermostability. The following methodological approaches are particularly effective:

X-ray Crystallography Optimization:
For membrane proteins like htpX1, crystallization requires specialized techniques. Researchers should employ lipidic cubic phase (LCP) or bicelle crystallization methods that maintain the native-like membrane environment. Alternatively, creating fusion constructs with crystallization chaperones such as T4 lysozyme or BRIL can enhance crystal formation. The thermostability of htpX1 provides an advantage, as it may remain folded in detergent conditions that would denature mesophilic membrane proteins.

Cryo-EM Approaches:
Single-particle cryo-electron microscopy offers advantages for membrane proteins that resist crystallization. For htpX1, reconstitution in nanodiscs composed of archaeal-like lipids can provide a native-like environment while adding sufficient mass for effective imaging. The following protocol is recommended:

  • Express htpX1 with a cleavable purification tag

  • Purify in mild detergents (DDM or LMNG)

  • Reconstitute with MSP1D1 scaffold proteins and archaeal-like lipids

  • Remove detergent using Bio-Beads

  • Verify homogeneity by size-exclusion chromatography

  • Screen buffer conditions (pH 6.0-8.0) with varying salt concentrations

  • Apply to cryo-EM grids with thin ice thickness to enhance contrast

Solution NMR with Selective Labeling:
While challenging for full-length membrane proteins, NMR can provide valuable dynamic information about htpX1. Selective methyl labeling of isoleucine, leucine, and valine residues while maintaining deuteration of other positions can generate interpretable spectra even for larger membrane proteins. The thermostability of htpX1 allows for longer acquisition times at elevated temperatures, improving spectral resolution.

HDX-MS for Conformational Dynamics:
Hydrogen-deuterium exchange mass spectrometry (HDX-MS) is particularly valuable for studying conformational changes in htpX1 upon substrate binding or during catalysis. This technique can map solvent-accessible regions and conformational flexibility with peptide-level resolution, providing insights into mechanistic details without requiring a complete atomic structure.

Integrative Structural Biology Approach:
The most comprehensive structural understanding will come from combining multiple techniques:

By implementing this integrative approach, researchers can overcome the challenges inherent in membrane protein structural biology while capitalizing on the natural thermostability of htpX1 to generate robust structural models that inform mechanistic understanding.

What are the potential biotechnological applications of thermostable proteases like htpX1?

Thermostable proteases like Sulfolobus tokodaii Protease HtpX homolog 1 (htpX1) offer considerable potential for biotechnological applications due to their exceptional stability and activity under extreme conditions. These enzymes can function effectively at elevated temperatures, in the presence of organic solvents, and across a broad pH range—properties that make them valuable biocatalysts for various industrial and research applications.

Biocatalysis for Peptide Synthesis:
Thermostable proteases can catalyze peptide bond formation under conditions that favor synthesis over hydrolysis. htpX1, with its specificity for membrane protein substrates, could be particularly useful for synthesizing hydrophobic peptides that are challenging to produce using conventional methods. The optimized reaction conditions would include:

  • Elevated temperatures (60-80°C) to increase solubility of hydrophobic substrates

  • Organic solvent mixtures (up to 50% DMSO or DMF) to dissolve both hydrophilic and hydrophobic amino acids

  • Controlled water activity to favor synthesis over hydrolysis

  • Immobilization on suitable carriers to enable reuse and enhance stability

Protein Engineering Applications:
htpX1 can serve as a scaffold for protein engineering efforts aimed at creating proteases with novel specificities or enhanced properties:

  • Directed evolution libraries can be screened at high temperatures, providing a selection pressure that ensures both catalytic activity and thermostability

  • The unique substrate binding pocket of htpX1 could be modified to create proteases with highly specific cleavage patterns

  • Chimeric enzymes combining the thermostable core of htpX1 with substrate recognition domains from other proteases could yield novel biocatalysts

Biotechnological Process Development:
The following table outlines potential industrial applications and the advantages of htpX1-derived enzymes for each:

ApplicationAdvantage of htpX1-based EnzymesProcess Parameters
Bioremediation of hydrophobic pollutantsStability in organic solvents, activity at high temperatures60-80°C, pH 6-9, presence of detergents
Peptide mapping in proteomic analysisSpecific cleavage patterns, compatibility with MS detectionHigh temperature digestion to denature resistant proteins
Enzymatic treatment of recalcitrant proteinsAbility to process membrane proteins and aggregatesElevated temperatures to solubilize aggregates
Enzymatic synthesis of specialized peptidesThermodynamic control of reaction equilibriumLow water activity, high temperature, controlled pH

Experimental Design Considerations:
For effective biotechnological application, researchers should focus on:

  • Optimizing expression systems for high-yield production, potentially using thermophilic expression hosts

  • Developing immobilization strategies that preserve activity while enabling reuse

  • Determining substrate specificity profiles under various reaction conditions

  • Engineering variants with enhanced tolerance to organic solvents or detergents

  • Characterizing long-term stability under process-relevant conditions

By exploiting the intrinsic thermostability and unique specificity of htpX1, researchers can develop novel biocatalytic processes that operate under conditions prohibitive for conventional enzymes. This approach leverages the evolutionary adaptations of extremophile proteins to create biocatalysts with industrial relevance and commercial potential.

What computational approaches can enhance our understanding of htpX1 function and interactions?

Advanced computational approaches offer powerful tools for elucidating the function, mechanism, and interactions of Sulfolobus tokodaii Protease HtpX homolog 1 (htpX1). These in silico methods can guide experimental design and provide mechanistic insights that may be challenging to obtain through experimental techniques alone.

Homology Modeling and Structural Refinement:
For detailed structural analysis, researchers should implement a multi-stage computational pipeline:

  • Generate initial homology models using templates from bacterial HtpX homologs or related metalloproteases

  • Refine transmembrane domain predictions using specialized algorithms like TMHMM or MEMSAT

  • Incorporate sparse experimental constraints from crosslinking or mutagenesis studies

  • Perform extensive molecular dynamics simulations in explicit membrane environments

  • Validate models through energy minimization and Ramachandran plot analysis

This approach can generate reliable structural models even in the absence of experimental structures, providing a foundation for further computational studies.

Molecular Dynamics Simulations in Membrane Environments:
To understand htpX1 dynamics and substrate interactions:

  • Embed the protein model in archaeal-like membranes using CHARMM-GUI or similar tools

  • Simulate at elevated temperatures (80°C) to mimic native conditions

  • Apply enhanced sampling techniques such as accelerated MD or replica exchange

  • Analyze conformational changes, particularly around the active site

  • Identify water access channels and substrate binding pockets

Substrate Docking and Binding Energy Calculations:
To predict substrate specificity and binding modes:

  • Generate a library of potential substrate peptides based on known membrane protein sequences

  • Perform flexible docking using algorithms optimized for peptide-protein interactions

  • Calculate binding free energies using MM/PBSA or FEP methods

  • Analyze the contribution of individual residues to substrate recognition

  • Predict cleavage sites based on positioning relative to the catalytic zinc

Integration of Evolutionary Information:
Coevolutionary analysis can reveal functionally important residues and interactions:

  • Construct multiple sequence alignments of HtpX homologs across diverse species

  • Apply direct coupling analysis (DCA) or related methods to identify coevolving residue pairs

  • Use evolutionary trace methods to identify functionally important positions

  • Map conservation patterns onto structural models to identify functional surfaces

  • Predict protein-protein interaction interfaces based on evolutionary constraints

The following table outlines computational methods and their applications for htpX1 research:

Computational ApproachApplication to htpX1 ResearchExpected Insights
Ab initio Structure PredictionGenerate models of poorly conserved regionsNovel structural features specific to archaeal HtpX
Molecular DynamicsSimulate conformational changes during catalysisMechanistic details of substrate processing
Quantum Mechanics/Molecular MechanicsModel zinc coordination and catalytic mechanismElectronic structure of the active site during catalysis
Network AnalysisIdentify allosteric communication pathwaysRegulatory mechanisms and conformational changes
Machine LearningPredict substrate specificity from sequence featuresDevelopment of predictive tools for new substrates

Integration with Experimental Data:
For maximum impact, computational approaches should be integrated with experimental validation:

  • Use computational predictions to design targeted mutagenesis experiments

  • Apply molecular docking to interpret proteomic identification of cleavage sites

  • Use MD simulations to explain thermal stability properties observed experimentally

  • Develop machine learning models trained on experimental activity data to predict optimal substrates

By implementing these computational approaches, researchers can develop detailed mechanistic models of htpX1 function that account for its unique evolutionary adaptations and predict its behavior under various experimental conditions, accelerating both fundamental understanding and biotechnological applications.

What spectroscopic methods are most informative for studying the metal-binding properties of htpX1?

Spectroscopic characterization of the metal-binding properties of Sulfolobus tokodaii Protease HtpX homolog 1 (htpX1) is essential for understanding its catalytic mechanism as a metalloprotease. Various complementary techniques can provide detailed insights into zinc coordination, active site environment, and conformational changes associated with metal binding.

X-ray Absorption Spectroscopy (XAS):
XAS, including both XANES (X-ray Absorption Near Edge Structure) and EXAFS (Extended X-ray Absorption Fine Structure), provides direct information about the coordination environment of the zinc ion in htpX1:

  • XANES reveals the oxidation state and coordination geometry of zinc

  • EXAFS determines the identity, number, and distance of atoms coordinating the zinc ion

  • Sample preparation requires concentrated protein (1-2 mM) in a glycerol-containing buffer to prevent radiation damage

  • Data collection should be performed at multiple temperatures to distinguish structural from dynamic effects

  • Analysis should compare the native enzyme with variants where zinc-coordinating residues are mutated

Electron Paramagnetic Resonance (EPR) with Surrogate Metals:
While zinc is EPR-silent, substitution with paramagnetic metals can provide valuable information:

  • Replace zinc with cobalt(II) or copper(II), which have similar ionic radii but are EPR-active

  • Collect EPR spectra at various frequencies (X-band, Q-band) for comprehensive analysis

  • Analyze hyperfine coupling to determine the identity of coordinating atoms

  • Compare EPR signatures of the native enzyme versus substrate-bound forms

  • Correlate spectral changes with activity measurements using the same metal-substituted enzymes

Magnetic Circular Dichroism (MCD):
MCD spectroscopy is particularly valuable for studying zinc metalloproteases:

  • Collect temperature-dependent MCD spectra in the UV-visible range

  • Analyze charge-transfer transitions associated with metal coordination

  • Compare spectra in the presence of inhibitors that coordinate to the active site zinc

  • Use MCD to distinguish between different coordination geometries

  • Correlate spectral signatures with catalytic activity under different metal-loading conditions

Raman and Resonance Raman Spectroscopy:
These techniques can provide information about metal-ligand vibrations:

  • Collect Raman spectra using excitation wavelengths that enhance metal-ligand vibrations

  • Identify vibrational modes associated with zinc-histidine and zinc-water coordination

  • Monitor shifts in vibrational frequencies upon substrate or inhibitor binding

  • Use isotopic labeling (⁶⁴Zn vs. ⁶⁸Zn) to confirm assignments of metal-ligand vibrations

  • Perform temperature-dependent measurements to assess the stability of the metal coordination environment

The following table summarizes the different spectroscopic approaches and their specific applications:

Spectroscopic MethodInformation ProvidedExperimental Considerations for htpX1
X-ray Absorption SpectroscopyDirect measurement of zinc coordination environmentRequires synchrotron radiation; sample must be prepared to minimize radiation damage
EPR with Metal SubstitutionElectronic structure and geometry of the active siteRequires successful metal substitution without loss of structural integrity
Magnetic Circular DichroismTransitions associated with metal coordinationNeeds specialized instrumentation; sensitive to sample concentration
Resonance RamanVibrational modes of metal-ligand bondsRequires optimization of excitation wavelength; may need concentrated samples
Isothermal Titration CalorimetryThermodynamics of metal bindingCan determine binding stoichiometry and affinity; requires pure, concentrated protein

By systematically applying these spectroscopic methods, researchers can develop a comprehensive model of the metal-binding site in htpX1, including coordination geometry, ligand identity, and dynamic changes associated with catalysis. This information is crucial for understanding the catalytic mechanism and developing strategies to modulate activity through metal coordination chemistry.

How can researchers effectively analyze the interaction between htpX1 and membrane-associated substrates?

Analyzing interactions between htpX1 and membrane-associated substrates presents unique challenges due to the hydrophobic nature of both the enzyme and its substrates. Effective characterization requires specialized techniques that maintain the native membrane environment while providing quantitative binding and kinetic data.

Reconstitution Systems for Membrane-Associated Interactions:
To study htpX1-substrate interactions in a native-like context, researchers should consider several reconstitution approaches:

  • Nanodisc Technology:

    • Reconstitute htpX1 in nanodiscs containing archaeal-like lipids

    • Vary lipid composition to assess membrane environment effects

    • Control protein orientation through strategic placement of MSP fusion tags

    • Enable solution-phase biophysical studies without detergent interference

  • Proteoliposome Systems:

    • Co-reconstitute htpX1 and substrate proteins in liposomes

    • Assess proteolytic activity through time-course sampling and analysis

    • Use fluorescently labeled substrates for real-time monitoring

    • Employ density gradient centrifugation to isolate membrane-associated complexes

  • Supported Lipid Bilayers:

    • Create planar membrane systems compatible with surface-sensitive techniques

    • Monitor binding events in real-time using surface plasmon resonance

    • Visualize enzyme-substrate interactions with atomic force microscopy

    • Enable quantitative binding analysis in defined membrane environments

Biophysical Characterization Techniques:
Several specialized methods are particularly valuable for studying membrane protein interactions:

  • Förster Resonance Energy Transfer (FRET):

    • Label htpX1 and substrate proteins with appropriate donor-acceptor pairs

    • Monitor interaction-dependent energy transfer in real-time

    • Derive binding kinetics and proximity information

    • Determine the effect of temperature and membrane fluidity on interactions

  • Microscale Thermophoresis (MST):

    • Measure binding affinities in membrane-mimetic environments

    • Require minimal sample amounts compared to other techniques

    • Allow screening of multiple substrate candidates efficiently

    • Function across a wide temperature range suitable for thermophilic proteins

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Map interaction interfaces at peptide-level resolution

    • Identify conformational changes upon substrate binding

    • Compatible with detergent-solubilized systems

    • Distinguish between direct binding and allosteric effects

Experimental Protocol for Comprehensive Interaction Analysis:
The following methodology integrates multiple techniques for robust characterization:

  • Reconstitute htpX1 in nanodiscs with varying lipid compositions

  • Prepare substrate proteins separately in compatible membrane mimetics

  • Perform initial binding screening using MST to identify key substrates

  • Characterize binding kinetics using SPR or BLI with immobilized nanodiscs

  • Map interaction interfaces using HDX-MS or crosslinking mass spectrometry

  • Confirm functional relevance through activity assays in the same membrane system

  • Validate findings using site-directed mutagenesis of predicted interface residues

The following table outlines specialized approaches for different aspects of htpX1-substrate interactions:

Interaction ParameterRecommended TechniqueAdvantages for Membrane Protein Systems
Binding AffinityMicroscale ThermophoresisCompatible with detergents and nanodiscs; low sample consumption
Binding KineticsSurface Plasmon Resonance with Captured NanodiscsReal-time association/dissociation measurement in membrane context
Structural InterfaceCrosslinking Mass SpectrometryIdentifies proximal residues; compatible with membrane environments
Conformational ChangesHDX-MSPeptide-level resolution; detects both direct and allosteric effects
Functional ConsequenceFluorogenic Substrate Cleavage AssaysReal-time monitoring of proteolytic activity; quantitative readout

By implementing this integrated approach, researchers can characterize the interactions between htpX1 and its membrane-associated substrates in a biologically relevant context, generating insights into substrate recognition, binding dynamics, and the influence of the membrane environment on enzymatic activity.

What are the key considerations for designing a comprehensive research project on htpX1?

Designing a comprehensive research project on Sulfolobus tokodaii Protease HtpX homolog 1 (htpX1) requires strategic planning that integrates multiple experimental approaches while addressing the unique challenges associated with this thermophilic archaeal protease. A well-designed research program should address fundamental mechanistic questions while exploring potential applications in biotechnology and structural biology.

The following framework outlines key considerations for developing a robust research project:

1. Expression and Purification Optimization:
Begin with establishing reliable production systems that yield sufficient quantities of active enzyme:

  • Compare heterologous expression in E. coli, yeast, and thermophilic bacterial hosts

  • Optimize induction conditions, temperature, and duration to balance yield and proper folding

  • Develop purification protocols that preserve the native membrane association if required

  • Validate protein quality through activity assays, CD spectroscopy, and thermal stability measurements

2. Structural Characterization Strategy:
Implement a multi-technique approach for structural elucidation:

  • Apply integrated structural biology combining X-ray crystallography, cryo-EM, and NMR

  • Validate structures with complementary biophysical techniques (SAXS, HDX-MS)

  • Focus on capturing different functional states (apo, substrate-bound, product-bound)

  • Compare structures across temperature ranges to understand thermostability mechanisms

3. Functional and Mechanistic Studies:
Design experiments to elucidate the catalytic mechanism and substrate specificity:

  • Develop robust activity assays compatible with elevated temperatures

  • Perform systematic mutagenesis of catalytic and substrate-binding residues

  • Characterize metal binding and its impact on catalysis

  • Identify physiologically relevant substrates through proteomic approaches

4. Evolutionary and Comparative Analysis:
Context the findings within broader evolutionary frameworks:

  • Compare htpX1 with homologs from different domains of life

  • Analyze the genomic context and potential co-evolution with substrate proteins

  • Study adaptation to extreme environments through comparative biochemistry

  • Reconstruct the evolutionary history of the HtpX protease family

5. Application Development:
Explore biotechnological potential based on fundamental insights:

  • Screen for novel activities under extreme conditions

  • Develop enzyme engineering strategies for enhanced stability or altered specificity

  • Investigate potential applications in biocatalysis and protein engineering

  • Explore medical and industrial applications leveraging thermostability

Project Timeline and Resource Allocation:
A comprehensive project should be structured in phases:

Project PhaseTimelineKey MilestonesResource Requirements
Initial Characterization6-12 monthsOptimized expression/purification protocol; Basic biochemical parametersMolecular biology equipment; Protein purification systems
Structural Studies12-24 monthsSolved structure in at least one state; Identified key structural featuresAccess to synchrotron; Cryo-EM facility; Computational resources
Functional Mechanism12-18 monthsCharacterized catalytic mechanism; Identified natural substratesMass spectrometers; Enzyme kinetics equipment; Biophysical instrumentation
Comparative Analysis6-12 monthsEvolutionary model of htpX proteases; Identified unique adaptationsBioinformatics resources; Computational servers
Application Development12-24 monthsProof-of-concept for at least one biotechnological applicationEnzyme screening facilities; Application-specific equipment

Interdisciplinary Collaboration Strategy:
Success requires expertise across multiple disciplines:

  • Structural biologists for protein structure determination

  • Enzymologists for mechanistic studies

  • Computational scientists for modeling and evolutionary analysis

  • Biotechnologists for application development

  • Microbiologists specializing in extremophiles

By implementing this comprehensive framework, researchers can develop a cohesive research program that advances fundamental understanding of htpX1 while exploring its potential applications, contributing significantly to our knowledge of archaeal proteases and extremophile biology.

What future research directions appear most promising for advancing our understanding of htpX1 and related archaeal proteases?

The exploration of Sulfolobus tokodaii Protease HtpX homolog 1 (htpX1) and related archaeal proteases stands at the intersection of several cutting-edge research frontiers. Future investigations should capitalize on emerging technologies while addressing fundamental gaps in our understanding of these unique enzymes.

Integration of Structural Dynamics and Function:
A particularly promising direction involves characterizing the relationship between protein dynamics and catalytic function across temperature ranges:

  • Apply time-resolved structural methods (TR-SAXS, TR-XFD) to capture conformational changes during catalysis

  • Implement single-molecule FRET to observe individual catalytic cycles in real-time

  • Correlate dynamics with function through temperature-dependent kinetic studies

  • Develop computational models that integrate structural flexibility into catalytic mechanisms

  • Compare dynamics between mesophilic and thermophilic HtpX homologs to identify key adaptations

Systems Biology of Proteolytic Networks in Archaea:
Expanding beyond single-enzyme studies to understand protease networks:

  • Apply quantitative proteomics to map the complete degradome of S. tokodaii

  • Characterize interactions between different proteolytic systems under stress conditions

  • Develop archaeal-specific protein quality control models

  • Investigate regulatory mechanisms controlling proteolytic activity

  • Elucidate the role of htpX1 in archaeal membrane protein homeostasis

Synthetic Biology Applications:
Leveraging unique properties of htpX1 for synthetic biology tools:

  • Engineer temperature-responsive protein degradation systems based on htpX1

  • Develop archaeal expression systems incorporating controlled proteolysis

  • Create synthetic circuits utilizing thermostable proteases as regulatory elements

  • Design self-assembling protein systems with protease-triggered reconfiguration

  • Implement protease-based biosensors for extreme environments

Extreme Biophysics and Adaptation Mechanisms:
Understanding the molecular basis of thermostability:

  • Investigate the role of post-translational modifications in thermophilic enzymes

  • Characterize protein-lipid interactions in archaeal membranes at high temperatures

  • Develop high-temperature structural biology methods to observe proteins in native-like states

  • Study the co-evolution of proteases and substrates in extreme environments

  • Apply ancestral sequence reconstruction to trace the evolution of thermostability

The following table outlines specific research questions and methodological approaches for the next generation of htpX1 research:

Research DirectionKey QuestionsInnovative Methodologies
Active Site DynamicsHow does thermal motion contribute to catalysis?Hydrogen-deuterium exchange at elevated temperatures; Molecular dynamics simulations with polarizable force fields
Substrate Recognition NetworksWhat determines substrate prioritization in vivo?Proximity-dependent labeling in archaeal cells; Competitive proteomics
Evolutionary AdaptationHow did htpX evolve temperature adaptation?Ancestral sequence reconstruction; Deep mutational scanning
Novel Catalytic ActivitiesCan htpX1 catalyze non-canonical reactions?High-throughput substrate screening; Directed evolution under extreme conditions
Membrane Protein Quality ControlHow does htpX1 recognize misfolded membrane proteins?In vitro reconstitution of complete degradation pathways; Cryo-EM of substrate-bound complexes

Technological Development Needs:
Advancing these research directions requires parallel development of enabling technologies:

  • High-temperature compatible structural biology methods

  • Archaeal genetic tools for in vivo studies

  • Advanced computational models for extremophilic proteins

  • Biophysical instrumentation capable of measurements at elevated temperatures

  • Synthetic archaeal membrane systems for reconstitution studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.