Recombinant Sulfolobus tokodaii Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Sulfolobus tokodaii Undecaprenyl-diphosphatase (uppP)

Recombinant Sulfolobus tokodaii Undecaprenyl-diphosphatase (uppP) is a thermostable enzyme engineered for biochemical and structural studies. It catalyzes the dephosphorylation of undecaprenyl pyrophosphate (UPP) to undecaprenyl phosphate (UP), a critical carrier lipid in bacterial cell wall biosynthesis . This enzyme is produced recombinantly in heterologous systems such as mammalian cells (CSB-MP822331FPN1) and yeast (CSB-YP822331FPN1), with >85% purity confirmed by SDS-PAGE . Its thermostability and acidophilic nature make it valuable for industrial and research applications under extreme conditions .

Production and Purification

Recombinant uppP is available in two expression systems:

FeatureMammalian Cell (CSB-MP822331FPN1)Yeast (CSB-YP822331FPN1)
SourceHEK293 cellsPichia pastoris
Purity>85% (SDS-PAGE)>85% (SDS-PAGE)
Storage-20°C/-80°C (liquid/lyophilized)-20°C/-80°C (liquid/lyophilized)
Reconstitution0.1–1.0 mg/mL in sterile water0.1–1.0 mg/mL in sterile water
TagDetermined during manufacturingDetermined during manufacturing

Both forms require glycerol (5–50%) for long-term stability and avoidance of repeated freeze-thaw cycles .

Biochemical Properties and Catalytic Activity

Key enzymatic parameters include:

  • Optimal pH: Activity spans pH 5–9, with peak catalysis in neutral to mildly acidic conditions (pH 7.0) .

  • Substrate Specificity: Utilizes farnesyl pyrophosphate (Fpp) as a substrate, with kinetic parameters (Kₘ and kₐₜ) determined via Malachite Green assays .

  • Thermostability: Retains activity at temperatures up to 80°C, consistent with S. tokodaii’s extremophilic origin .

Enzymatic assays employ 20–40 nM uppP, 10 mM MgCl₂, and 0.02% DDM, with reactions quantified spectrophotometrically at 650 nm .

Species-Specific Features and Biotechnological Relevance

S. tokodaii uppP exhibits unique adaptations:

  • N-Glycosylation: The enzyme’s interaction with lipid substrates may depend on species-specific N-glycans, as observed in S. tokodaii’s surface-layer glycoproteins . MALDI-TOF-MS analyses reveal predominant glycan structures such as QuiS₁Hex₄HexNAc₂ (97% abundance) .

  • Biotechnological Utility: As a thermostable phosphatase, it is explored for:

    • Synthesis of lipid-linked oligosaccharides in glycobiology .

    • High-temperature industrial processes requiring enzyme stability .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; bacA; upk; STK_18130; Undecaprenyl-diphosphatase; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-264
Protein Length
full length protein
Species
Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
Target Names
uppP
Target Protein Sequence
MNLLDIIIIGIVQGISEWLPISSKTQVLISSHYLLNLPIAIAYSFGLFMEMGSIGSATIY FRKDIMSVFRDRKLLLYLAIITIITGLVGVPLYIISDKLLKNAYDPSIPMIILGIALIVD GLYIRYSRIKIRSFKDLSLKNIILIGIAQGLAALPGVSRSGMTVSTMLFLGIKPDDAFRY SYLAYIPAAVGAVGTTILFSKTNISYVISLIGIGGVLISVISAFIIGMLTIDLLLRFAKR RNIYIIDFTLGGIAIVVSVLTILI
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP).
Database Links
Protein Families
UppP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what is its biological role in Sulfolobus tokodaii?

Undecaprenyl-diphosphatase (uppP), also known as Undecaprenyl pyrophosphate phosphatase (EC 3.6.1.27), is an integral membrane protein that plays a critical role in cell wall biosynthesis in archaea and bacteria. In Sulfolobus tokodaii, this enzyme catalyzes the dephosphorylation of undecaprenyl pyrophosphate to undecaprenyl phosphate, which serves as an essential carrier lipid in cell wall synthesis . The enzyme is encoded by the uppP gene (also known by synonyms bacA and upk) with the ordered locus name STK_18130 in S. tokodaii strain DSM 16993 / JCM 10545 / NBRC 100140 / 7 . This dephosphorylation reaction represents a critical step in the lipid carrier cycle, which is essential for the assembly of cell wall components in this thermoacidophilic archaeon.

What are the optimal storage and handling conditions for recombinant S. tokodaii uppP for maximum stability and activity?

Recombinant S. tokodaii uppP requires specific storage and handling conditions to maintain stability and enzymatic activity. According to product specifications, the purified protein should be stored at -20°C for regular use, while extended storage is recommended at -20°C or -80°C . The protein is typically maintained in a Tris-based buffer containing 50% glycerol, which has been optimized for this specific protein to enhance stability . For working with the enzyme, it is advisable to prepare aliquots to avoid repeated freeze-thaw cycles, which can compromise activity. Working aliquots can be stored at 4°C for up to one week . As a thermostable enzyme from an extremophile, S. tokodaii uppP exhibits greater stability than mesophilic homologs, but appropriate buffer conditions must still be maintained to preserve the native conformation and catalytic capacity of the enzyme during experimental procedures.

What expression systems are most effective for producing recombinant S. tokodaii uppP with optimal activity?

While the search results don't provide specific information about S. tokodaii uppP expression systems, insights can be drawn from related research on membrane proteins and archaeal enzymes. For E. coli UppP, successful expression has been achieved using E. coli C41(DE3) as a host strain, with a bacteriorhodopsin fusion tag at the N-terminus to facilitate membrane protein expression and purification . For archaeal proteins from Sulfolobus species, heterologous expression in E. coli often requires optimization for the different codon usage and post-translational modifications. Expression constructs typically include a strong inducible promoter system like T7, with induction using IPTG at concentrations around 0.5 mM . The timing and temperature of induction can significantly impact the proper folding of membrane proteins like uppP. For thermostable proteins from S. tokodaii, lower expression temperatures (30°C rather than 37°C) sometimes yield better results despite the thermophilic nature of the source organism, as this allows slower folding in the heterologous host. Codon optimization for E. coli expression and the inclusion of appropriate secretion signals or solubility tags may also improve recombinant protein yields.

What purification methods provide the highest purity and yield for recombinant S. tokodaii uppP?

Effective purification of membrane proteins like S. tokodaii uppP typically requires specialized techniques. Drawing from methodologies used for similar membrane proteins, a successful approach involves first harvesting cells and resuspending them in an appropriate buffer (such as 50 mM Tris, pH 7.5, 500 mM NaCl) . Cell disruption can be achieved using systems like the Constant Cell Disruption System, followed by ultracentrifugation at approximately 40,000 rpm for 1.5 hours to collect the membrane fraction . The membrane pellet then requires solubilization with detergents, with n-dodecyl-β-D-maltoside (DDM) being commonly used at concentrations around 1% for initial extraction . Purification typically employs affinity chromatography utilizing the affinity tag incorporated during recombinant expression. For thermostable proteins from Sulfolobus species, a heat treatment step (65-70°C) prior to chromatography can sometimes be employed to remove heat-labile E. coli proteins, improving purity. Final purification steps often include size exclusion chromatography to achieve high purity while maintaining the protein in appropriate detergent micelles to preserve the native conformation and activity of this integral membrane protein.

How can researchers assess the purity and activity of recombinant S. tokodaii uppP preparations?

Assessment of recombinant S. tokodaii uppP requires both purity and activity analyses. For purity assessment, SDS-PAGE under reducing conditions is the standard method, typically showing a band corresponding to the expected molecular weight of the protein (based on its 264 amino acid length) . Western blotting using antibodies against the affinity tag or the protein itself provides further confirmation of identity. For membrane proteins like uppP, additional consideration of detergent micelles is important when interpreting gel migration patterns. Activity assessment can be performed using a phosphatase assay that measures the release of inorganic phosphate from undecaprenyl pyrophosphate. A practical method involves using a colorimetric assay with Malachite Green reagent to quantify released phosphate, measuring absorbance at 650 nm against a phosphate standard curve . Reaction conditions would typically include a buffer system at the optimal pH (likely acidic, given the acidophilic nature of S. tokodaii), appropriate salt concentration, magnesium ions as cofactors, detergent to maintain protein solubility, and the substrate (often farnesyl pyrophosphate can be used as a surrogate substrate) . Specific activity calculations should account for protein concentration, reaction time, and the amount of phosphate released under standardized conditions.

What computational approaches are recommended for modeling the structure of S. tokodaii uppP given the challenges of membrane protein crystallography?

For membrane proteins like S. tokodaii uppP where experimental structures may be challenging to obtain, computational modeling approaches provide valuable structural insights. Based on methodologies used for related proteins, a multi-faceted approach is recommended. Initial secondary structure prediction should identify transmembrane helices and topology, using algorithms specialized for membrane proteins. Homology modeling can be attempted if bacterial homologs with known structures exist, though sequence divergence between archaeal and bacterial proteins may limit accuracy. For more reliable results, membrane-specific ab initio modeling methods, such as those implemented in Rosetta Membrane, are recommended . This approach has been successfully applied to E. coli UppP, generating models by using fragment libraries (typically 3 and 9 amino acid fragments), followed by Monte Carlo-based membrane normal cycles (around 40 cycles with 15° angle search steps and 2 Å center search steps) . The resulting models should be filtered based on known or predicted functional residues, such as conserved motifs that form the active site. Molecular dynamics simulations in explicit membrane environments can further refine these models and provide insights into protein dynamics and substrate interactions. Validation should include energy minimization and assessment of model quality using specialized tools for membrane protein structural evaluation.

Which amino acid residues are critical for the catalytic activity of S. tokodaii uppP, and how can their roles be experimentally verified?

While specific experimental data on S. tokodaii uppP catalytic residues is not directly available in the search results, insights can be derived from homologous enzymes. In E. coli UppP, critical catalytic residues include those in the (E/Q)XXXE and PGXSRSXXT motifs, with specific residues like Glu-21, His-30, and Arg-174 forming a catalytic pocket within 10 Å of each other . For S. tokodaii uppP, sequence alignment with bacterial homologs would help identify conserved residues likely involved in catalysis. To experimentally verify these residues, site-directed mutagenesis should be performed, targeting conserved acidic residues (Glu/Asp), basic residues (His, Arg, Lys), and those in predicted active site motifs . For each mutant (e.g., replacing Glu with Ala or Gln), expression and purification would follow the same protocol as for the wild-type enzyme. Enzymatic activity assays using colorimetric phosphate detection (such as Malachite Green assay) would then quantify the impact of each mutation on catalytic efficiency . Kinetic parameters (Km, kcat) should be determined under standardized conditions (suitable buffer, pH, temperature, detergent concentration) by varying substrate concentration (0.3-57 μM range for surrogate substrates like farnesyl pyrophosphate) . A significant reduction in kcat or increase in Km for specific mutants would confirm the importance of those residues, while structural modeling could provide context for interpreting these results in terms of substrate binding or catalytic mechanism.

How does the membrane environment affect the activity and stability of S. tokodaii uppP, and what lipid compositions optimize its function?

The membrane environment significantly impacts the activity and stability of integral membrane proteins like S. tokodaii uppP. Being from a thermoacidophilic archaeon, S. tokodaii uppP naturally functions in archaeal membranes with unique lipid compositions different from bacterial or eukaryotic systems. Archaeal membranes typically contain ether-linked isoprenoid chains rather than the ester-linked fatty acids found in bacteria, providing enhanced stability under extreme conditions . For optimal activity in vitro, detergent selection is critical, with mild non-ionic detergents like n-dodecyl-β-D-maltoside (DDM) at concentrations around 0.02% typically maintaining membrane protein function during assays . For more native-like environments, reconstitution into liposomes or nanodiscs with lipid compositions mimicking archaeal membranes would provide a better representation of physiological conditions. Studies on the pH-dependence of activity would also be informative, testing buffers across a range of pH values (pH 5-9) to determine the optimal conditions that reflect the acidophilic nature of S. tokodaii . The presence of divalent cations, particularly Mg2+, at concentrations around 10 mM, is typically important for phosphatase activity . Temperature stability studies should assess activity retention after incubation at elevated temperatures (65-80°C), reflecting the thermophilic nature of this enzyme. Such characterization would provide valuable insights into the unique adaptations of this archaeal enzyme to extreme membrane environments.

How do the properties of uppP differ between various Sulfolobus species, and what does this reveal about their evolutionary adaptations?

The properties of uppP likely differ between Sulfolobus species in ways that reflect their ecological niches and evolutionary adaptations. While the search results don't provide direct comparisons of uppP across Sulfolobus species, broader species-specific differences are evident. Different Sulfolobus species have developed unique surface features and recognition mechanisms, as evidenced by the species-specific regions in their Ups pili subunits that allow them to interact only with cells from the same species . This species specificity extends to glycosylation patterns, with S. tokodaii having a different N-glycan composition decorating its S-layer compared to S. acidocaldarius . These differences suggest that membrane-associated proteins like uppP may also have species-specific adaptations. The uppP enzyme from S. tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) likely has optimizations for its particular growth environment, which may differ in temperature, pH, or chemical composition from other Sulfolobus habitats . Comparative sequence analysis of uppP across Sulfolobus species would reveal conserved catalytic residues versus variable regions that might confer species-specific properties. Such differences could influence substrate specificity, catalytic efficiency, temperature optima, or interactions with other components of the cell wall synthesis machinery, reflecting the evolutionary divergence of these thermoacidophilic archaea.

How does N-glycosylation affect the function of S. tokodaii uppP, and how does it compare to glycosylation patterns in related species?

N-glycosylation likely plays a significant role in the function of S. tokodaii uppP, though direct experimental evidence is not provided in the search results. The search results indicate that S. tokodaii has a unique N-glycan composition decorating its S-layer that differs from that of related species like S. acidocaldarius . This species-specific glycosylation pattern suggests that membrane-associated proteins like uppP may also be subject to distinct post-translational modifications. N-glycosylation in archaea often enhances protein stability under extreme conditions and can influence protein-protein interactions within the membrane environment. For integral membrane proteins like uppP, glycosylation of extracellular loops could affect substrate access to the active site, protein stability, or interactions with other components of the cell wall synthesis machinery. The archaeal N-glycosylation pathway involves dolichol-based carriers analogous to but distinct from the eukaryotic system, with the sugar N-acetylglucosamine (GlcNAc)-1-phosphate first added to dolichol phosphate (DolP) to yield dolichol pyrophosphate (DolPP)-bound GlcNAc-1-phosphate . Given that uppP processes undecaprenyl pyrophosphate, there may be interesting regulatory interactions between the pathways for N-glycosylation and cell wall synthesis in these organisms. Experimental approaches to study these effects would include site-directed mutagenesis of potential glycosylation sites, glycosidase treatments, and comparative analysis of enzyme kinetics between glycosylated and non-glycosylated forms of the protein.

What can comparative genomics reveal about the conservation and specialization of uppP across archaeal and bacterial domains?

Comparative genomics analysis of uppP across archaeal and bacterial domains would reveal important insights about its evolution and specialization. The gene for undecaprenyl-diphosphatase in S. tokodaii is annotated as uppP with synonyms bacA and upk (locus STK_18130), indicating evolutionary relationships with bacterial counterparts despite the substantial differences between archaeal and bacterial cell walls . In bacteria like E. coli, UppP is an integral membrane protein with multiple transmembrane domains, containing characteristic motifs like (E/Q)XXXE and PGXSRSXXT that form the active site . Genomic analysis would likely reveal that these catalytic motifs are conserved across domains, reflecting the fundamental chemistry of phosphate hydrolysis, while other regions might show domain-specific adaptations. The archaeal enzyme would be expected to show sequence adaptations reflecting the different membrane composition and extreme conditions of archaeal habitats. Analysis of gene neighborhoods might also reveal different genomic contexts, with bacterial uppP potentially clustered with other cell wall synthesis genes, while the archaeal version might show different organizational patterns. The presence of paralogs or alternative phosphatases in some species could indicate redundancy or specialization of function. Horizontal gene transfer events might be detected through phylogenetic incongruence, potentially revealing exchanges between thermophilic bacteria and archaea that share extreme habitats. Such analysis would provide a broader evolutionary context for understanding the specialization of S. tokodaii uppP in archaeal cell wall biosynthesis.

How can S. tokodaii uppP be utilized as a model system for studying membrane protein function in extremophiles?

S. tokodaii uppP presents an excellent model system for studying membrane protein function in extremophiles due to several favorable characteristics. As an enzyme from a thermoacidophilic archaeon, it offers insights into protein adaptations for function under extreme conditions (high temperature, low pH). Researchers can exploit this system to investigate fundamental questions about protein stability, membrane integration, and catalysis in extreme environments. Experimental approaches should begin with comprehensive biochemical characterization, determining the temperature and pH optima, which for S. tokodaii proteins typically fall in the range of 75-85°C and pH 2-4. Stability studies comparing wild-type and engineered variants can identify key features conferring thermostability. The effect of different detergents and lipid environments on activity would illuminate membrane-protein interactions under extreme conditions. Comparative studies with mesophilic homologs (e.g., E. coli UppP) using chimeric proteins could pinpoint regions responsible for extremophilic adaptations . Advanced biophysical techniques like hydrogen-deuterium exchange mass spectrometry under varying temperature conditions could reveal dynamic aspects of protein stability. Functional reconstitution into archaeal-mimicking liposomes would allow investigation of transport and catalysis in a native-like membrane environment. This model system could also serve as a platform for engineering enhanced thermostability into other membrane proteins of biotechnological interest.

What methodologies are most effective for studying the in vivo function of uppP in Sulfolobus tokodaii, given the challenges of archaeal genetics?

Studying the in vivo function of uppP in S. tokodaii requires specialized approaches due to the challenges of archaeal genetics. Based on recent advancements in Sulfolobus research, several methodologies can be recommended. For genetic manipulation, a plasmid-based approach has been developed for Sulfolobus species, as evidenced by the construction of vectors like pCYZ1 containing S. tokodaii genes . CRISPR-Cas9 systems adapted for extreme conditions have also shown promise in some archaeal species. For chromosomal integration, researchers have employed multi-omics approaches to guide the selection of integration sites within the Sulfolobus genome . Gene knockdown rather than knockout may be preferable for essential genes like uppP, potentially using antisense RNA strategies or conditional expression systems. For functional analysis, reporter gene assays using thermostable reporters like β-galactosidase from Saccharolobus solfataricus can monitor gene expression under different conditions . Metabolic labeling using radiolabeled precursors can track cell wall synthesis in vivo. Subcellular localization studies using immunofluorescence with antibodies against uppP or fluorescent protein fusions (using thermostable variants) would reveal the protein's distribution within the cell. Cell wall synthesis inhibitors affecting steps before or after uppP could be used to probe pathway dependencies. Growth studies under varying conditions (temperature, pH, osmotics) comparing wild-type and uppP-modified strains would reveal phenotypic consequences of altered uppP function. These approaches, while technically challenging, would provide valuable insights into the in vivo role of this enzyme in archaeal cell wall biosynthesis.

How can structural and functional insights from S. tokodaii uppP contribute to the development of novel antimicrobials targeting bacterial cell wall synthesis?

The structural and functional insights from S. tokodaii uppP could make significant contributions to antimicrobial drug discovery despite targeting an archaeal enzyme. The bacterial homolog (UppP/BacA) is essential for cell wall synthesis and represents an attractive antibiotic target that is distinct from those targeted by current antibiotics . The archaeal version from S. tokodaii offers several advantages for drug discovery efforts. First, its thermostability facilitates structural studies that might be challenging with bacterial homologs. Crystallization trials or cryo-EM studies of S. tokodaii uppP might succeed where bacterial versions have failed, providing structural templates for in silico drug design. Additionally, the archaeal enzyme can serve as a control in high-throughput screening assays, allowing identification of compounds that selectively inhibit bacterial but not archaeal homologs, thus potentially reducing toxicity to human cells. Structure-activity relationship studies comparing bacterial and archaeal enzymes could highlight critical differences in the active site that could be exploited for selective inhibition. The established expression and purification protocols for S. tokodaii uppP provide a foundation for developing robust screening assays . A screening cascade might begin with biochemical assays measuring phosphatase activity inhibition, followed by selectivity testing against the archaeal enzyme, culminating in whole-cell testing against pathogenic bacteria. The unique catalytic mechanism and membrane integration of this essential enzyme family present opportunities for developing antibiotics with novel mechanisms of action, addressing the critical need for new strategies against antimicrobial resistance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.