Recombinant Sulfolobus tokodaii UPF0290 protein STK_04650 (STK_04650)

What is Sulfolobus tokodaii UPF0290 protein STK_04650 and why is it significant for research?

Sulfolobus tokodaii UPF0290 protein STK_04650 (UniProt ID: Q975E2) is a 166-amino acid protein from the hyperthermophilic archaeon Sulfolobus tokodaii. This protein, also known as carS, functions as CDP-archaeol synthase or CDP-2,3-bis-(O-geranylgeranyl)-sn-glycerol synthase . It is significant for research due to its role in archaeal membrane lipid biosynthesis, which differs structurally from bacterial and eukaryotic membrane lipids. Studies on this protein contribute to our understanding of archaeal membrane biology, adaptation to extreme environments, and evolutionary divergence in lipid biosynthesis pathways. The recombinant version allows researchers to study this protein in controlled laboratory conditions outside its native extreme thermophilic environment .

How does the amino acid sequence of STK_04650 relate to its predicted structure and function?

The amino acid sequence of STK_04650 (MPIIYYVIFAILYYLPALVANGSAPFVKNGTPIDFRKNFVDGRRLLGDGKTFEGLLVAVTFGTTVGIILAKFLGIYWIYVSFIESLLAMLGDMVGAFIKRRLGLARGARAIGLDQLDFILGATLALIISKISLNIYEFLSIVVIAFVLHILTNNVAYRLKIKSVPW) reveals several structural and functional characteristics . The protein contains multiple hydrophobic regions that likely form transmembrane domains, consistent with its role in membrane lipid biosynthesis. Analysis of this sequence indicates:

• N-terminal hydrophobic region suggesting membrane association

• Conserved motifs associated with CDP-alcohol phosphatidyltransferase activity

• Hydrophobic core regions crucial for interaction with lipid substrates

• C-terminal domain potentially involved in protein-protein interactions

These features support its putative function as CDP-archaeol synthase, where it would catalyze a critical step in the synthesis of archaeal membrane lipids by transferring CDP-activated alcohol groups to form phosphodiester linkages in the membrane lipid biosynthesis pathway .

What are the optimal reconstitution protocols for lyophilized STK_04650 to ensure maximum activity?

The optimal reconstitution protocol for lyophilized STK_04650 should consider the protein's native thermophilic environment while ensuring stability in laboratory conditions. Based on established protocols:

• Centrifuge the vial briefly before opening to bring contents to the bottom

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 50% to enhance stability

• Aliquot the reconstituted protein to minimize freeze-thaw cycles

• For enzyme activity assays, use Tris-based buffers at pH 8.0, which mirror the storage buffer composition

The addition of glycerol is particularly important as it prevents protein denaturation during freezing and mimics the physiological adaptations that thermophilic organisms employ to stabilize proteins at extreme temperatures. Researchers should avoid repeated freeze-thaw cycles, as these significantly reduce protein activity .

How do storage conditions affect the stability and activity of recombinant STK_04650 protein?

Storage conditions critically impact the stability and activity of recombinant STK_04650. The following table summarizes optimal storage parameters and their effects:

The protein should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 for optimal stability . Addition of 5-50% glycerol (ideally 50%) to reconstituted protein significantly enhances stability during freeze-thaw cycles. For active enzyme preparations, it's essential to store aliquots rather than the entire stock to preserve enzymatic activity for extended periods .

What are the critical factors for optimizing heterologous expression of STK_04650 in E. coli systems?

Heterologous expression of STK_04650 in E. coli presents several challenges due to the thermophilic origin of the protein. Critical optimization factors include:

• Codon optimization: Sulfolobus tokodaii has different codon usage bias compared to E. coli, necessitating codon optimization of the gene sequence to enhance expression

• Expression vector selection: Vectors with strong promoters (T7) and temperature-inducible systems work effectively

• Host strain selection: BL21(DE3) derivatives with enhanced tolerance for potentially toxic membrane proteins are preferred

• Induction conditions: Lower induction temperatures (15-25°C) despite the thermophilic nature of the protein, as this reduces inclusion body formation in E. coli

• Media composition: Enriched media with osmotic stabilizers improve expression yields

The addition of N-terminal His-tag, as employed in the described recombinant protein, facilitates purification without significantly affecting protein function . Researchers should monitor growth carefully after induction, as overexpression of membrane-associated proteins can be toxic to E. coli cells.

What purification strategy yields the highest purity and activity for recombinant STK_04650?

A multi-step purification strategy yields optimal results for recombinant His-tagged STK_04650:

• Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin with imidazole gradient elution

• Intermediate purification: Ion exchange chromatography to remove E. coli contaminants

• Polishing step: Size exclusion chromatography to separate aggregates and achieve >90% purity

• Buffer optimization: Final exchange into Tris/PBS-based buffer with 6% trehalose

This strategy consistently yields protein with greater than 90% purity as determined by SDS-PAGE . For functional studies, it's crucial to verify that the purified protein maintains its native conformation through circular dichroism or limited proteolysis assays. The purification should be performed rapidly at controlled temperatures to minimize degradation of the thermophilic protein in mesophilic conditions.

How can researchers effectively assess the enzymatic activity of STK_04650 in vitro?

Assessing the enzymatic activity of STK_04650 (CDP-archaeol synthase) requires specialized techniques due to its involvement in archaeal lipid biosynthesis:

• Substrate preparation: Synthesize or isolate CDP-archaeol and 2,3-bis-(O-geranylgeranyl)-sn-glycerol substrates

• Reaction conditions: Conduct assays at elevated temperatures (60-80°C) to mimic the thermophilic environment of S. tokodaii

• Detection methods:

  • Radiometric assay using 14C-labeled CDP-glycerol to monitor incorporation into archaeol

  • HPLC analysis of reaction products with appropriate lipid separation columns

  • Mass spectrometry to identify and quantify reaction products

A standardized activity assay protocol should include:

• Buffer: 50 mM Tris-HCl (pH 8.0), 10 mM MgCl2

• Substrates: 100 μM CDP-archaeol, 100 μM 2,3-bis-(O-geranylgeranyl)-sn-glycerol

• Temperature: 75°C (optimal for thermophilic enzyme)

• Reaction time: 30 minutes with time-course sampling

Activity should be reported as μmol product formed per minute per mg of purified protein. Using this standardized approach allows for comparative studies with other archaeal lipid biosynthesis enzymes .

What structural techniques are most informative for elucidating STK_04650's membrane interaction mechanisms?

Understanding STK_04650's membrane interactions requires complementary structural techniques:

For membrane interaction studies specifically:

• Solid-state NMR with isotopically labeled protein reconstituted in archaeal lipid mimics

• Fluorescence resonance energy transfer (FRET) using labeled protein and lipid vesicles

• Atomic force microscopy to visualize protein incorporation into lipid bilayers

• Molecular dynamics simulations based on homology models to predict membrane interaction surfaces

This multi-technique approach can reveal how the transmembrane domains of STK_04650 orient within archaeal membranes and how this orientation facilitates its enzymatic function in lipid biosynthesis .

How does STK_04650 compare structurally and functionally to homologous proteins in other archaeal species?

STK_04650 belongs to the UPF0290 protein family and shares structural and functional similarities with homologs in other archaea, particularly those from the Crenarchaeota phylum. Comparative analysis reveals:

These differences reflect evolutionary adaptations to varied extreme environments. The core catalytic domain remains conserved across these species, suggesting a fundamental role in archaeal lipid biosynthesis. The variations in transmembrane domains likely represent adaptations to specific membrane compositions and environmental conditions of each organism .

What insights can be gained from studying STK_04650 regarding the evolution of membrane lipid biosynthesis pathways?

Studying STK_04650 provides several evolutionary insights:

• Archaeal lipid distinctiveness: The enzyme catalyzes the synthesis of ether-linked isoprenoid lipids, fundamentally different from the ester-linked fatty acid lipids in bacteria and eukaryotes, supporting the three-domain model of life

• Adaptation to extreme environments: The thermal stability and acid resistance of the enzyme reflect adaptations to the extreme habitats of Sulfolobus species

• Conserved catalytic mechanisms: Despite divergent evolution, the catalytic mechanism shares similarities with bacterial and eukaryotic CDP-alcohol phosphatidyltransferases, suggesting common ancestry before domain divergence

• Specialized membrane architecture: The enzyme's structure reflects the unique adaptations required for functioning in archaeal monolayer membranes versus the bilayer structure common in bacteria and eukaryotes

These insights contribute to our understanding of the early divergence of archaea and the specialized adaptations that allowed colonization of extreme environments. The study of STK_04650 thus provides a window into both early evolutionary events and specialized adaptations in lipid metabolism .

How can STK_04650 be utilized in synthetic biology applications for creating thermostable membrane systems?

STK_04650's unique properties make it valuable for synthetic biology applications focused on thermostable membrane systems:

• Designer archaeosomes: Engineer lipid particles using STK_04650 to produce archaeal-type lipids in heterologous systems, creating vesicles with enhanced thermal and acid stability for drug delivery applications

• Hybrid membrane systems: Incorporate archaeal lipid synthesis pathways into bacterial cells to create hybrid membranes with improved stability under extreme conditions

• Cell-free lipid synthesis: Utilize purified STK_04650 in conjunction with other archaeal lipid biosynthesis enzymes in cell-free systems to produce designer lipids with specific properties

• Biocatalytic membrane modifications: Employ the enzyme to modify existing lipid membranes with archaeal-type linkages, enhancing their stability

Implementation protocol for heterologous expression system:

• Express STK_04650 along with other essential archaeal lipid biosynthesis enzymes

• Supply isoprenoid precursors through the mevalonate pathway

• Monitor membrane composition changes using mass spectrometry

• Assess membrane stability under various temperature and pH conditions

This approach enables the development of novel biomaterials with properties specifically adapted for extreme environments or specialized applications requiring exceptional stability .

What are the methodological considerations when using STK_04650 as a model for studying hyperthermophilic enzyme adaptations?

When using STK_04650 as a model for studying hyperthermophilic enzyme adaptations, researchers should consider:

• Temperature-dependent structural analysis:

  • Circular dichroism spectroscopy at various temperatures (25-95°C)

  • Differential scanning calorimetry to determine melting temperature

  • Temperature-resolved structural studies using SAXS or neutron scattering

• Comparative mutagenesis approach:

  • Identify residues unique to thermophilic homologs through sequence alignment

  • Create point mutations reverting to mesophilic-like residues

  • Assess thermal stability and activity of mutants

• Molecular dynamics simulations:

  • Model protein behavior at different temperatures

  • Identify stabilizing interactions that maintain structure at high temperatures

  • Simulate water-protein interactions at elevated temperatures

• Reconstitution in different membrane environments:

  • Compare activity in archaeal lipids versus bacterial lipids

  • Assess temperature-dependent membrane association

This methodological framework allows researchers to deconstruct the specific adaptations that enable STK_04650 to function at high temperatures, providing insights applicable to protein engineering for thermostability in biotechnological applications .

What are common pitfalls in working with recombinant STK_04650 and how can they be addressed?

Researchers frequently encounter specific challenges when working with recombinant STK_04650:

Implementing these targeted solutions can significantly improve experimental outcomes when working with this challenging archaeal protein .

What quality control metrics should be employed to ensure the integrity and activity of purified STK_04650?

Comprehensive quality control for purified STK_04650 should include:

• Purity assessment:

  • SDS-PAGE analysis with Coomassie staining (should show >90% purity)

  • Western blot using anti-His antibodies to confirm identity

  • Mass spectrometry to verify molecular weight and detect any modifications

• Structural integrity verification:

  • Circular dichroism to confirm secondary structure content

  • Fluorescence spectroscopy to assess tertiary structure

  • Size exclusion chromatography to detect aggregation

• Functional validation:

  • Enzymatic activity assay using standardized conditions (75°C, pH 8.0)

  • Substrate binding assays using fluorescent substrate analogs

  • Thermal shift assays to confirm expected thermostability profile

• Stability monitoring:

  • Activity retention after storage at different conditions

  • Repeat structural analyses after freeze-thaw cycles

  • Monitor for proteolytic degradation by SDS-PAGE