Recombinant Sulfoxide reductase heme-binding subunit YedZ (yedZ)

Shipped with Ice Packs
In Stock

Description

Introduction to YedZ/MsrQ

YedZ, alternatively designated as MsrQ in more recent literature, is an integral membrane protein originally identified in Escherichia coli. It functions as the heme-binding subunit of a sulfoxide reductase system that plays a crucial role in cellular redox processes. This protein has garnered increasing attention due to its involvement in the repair of oxidatively damaged proteins in the bacterial periplasm, particularly those affected by hypochlorous acid . The YedZ/MsrQ protein represents a fascinating example of a bacterial transmembrane electron transfer system with structural and functional relationships to eukaryotic oxidoreductases .

Initial characterization of YedZ revealed it to be a protein of unknown function, but subsequent research has illuminated its role as part of the MsrPQ methionine sulfoxide reductase system. This two-component system appears specifically evolved to address oxidative damage in the bacterial periplasmic space, representing an important defense mechanism against oxidative stress . The integral membrane nature of YedZ positions it ideally for mediating electron transfer between cytoplasmic electron donors and periplasmic acceptors.

Primary Structure and Domains

YedZ/MsrQ is a full-length protein consisting of 211 amino acids in Escherichia coli. The complete amino acid sequence has been determined as:
MRLTAKQVTWLKVSLHLAGLLPFLWLVWAINHGGLGADPVKDIQHFTGRTALKFLLATLLITPLARYAKQPLLIRTRRLLGLWCFAWATLHLTSYALLELGVNNLALLGKELITRPYLTLGIISWVILLALAFTSTQAMQRKLGKHWQQLHNFVYLVAILAPIHYLWSVKIISPQPLIYAGLAVLLLALRYKKLRSLFNRLRKQVHNKLSV .

This sequence encodes a protein with six transmembrane spanning (TMS) domains that traverse the bacterial cell membrane. Analysis of the evolutionary origins of YedZ suggests that the protein arose through an intragenic triplication of a 2 TMS-encoding genetic element, creating the characteristic six-transmembrane structure observed today .

Heme-Binding Sites

A distinguishing feature of YedZ is the presence of conserved histidyl residues within its transmembrane domains. These histidine residues serve as critical ligands for heme binding, providing the protein with its electron transfer capabilities . Detailed biochemical characterization combining UV-visible spectroscopy, heme quantification, and site-directed mutagenesis of histidine residues has demonstrated that YedZ can bind two b-type heme moieties through these conserved histidine residues .

The strategic positioning of these heme groups within the membrane-spanning regions of the protein facilitates electron transfer across the bacterial membrane. This arrangement enables YedZ to function effectively as a component of a transmembrane electron transport system, connecting cytoplasmic electron donors with periplasmic electron acceptors .

Role in Methionine Sulfoxide Reduction

YedZ/MsrQ serves as a critical component of the MsrPQ system, a newly identified methionine sulfoxide reductase system in bacteria. This system specifically participates in the repair of periplasmic proteins that have been oxidized by hypochlorous acid . The MsrPQ system consists of two key proteins: MsrP (previously named YedY), a periplasmic protein that carries out the methionine sulfoxide reductase activity, and MsrQ (YedZ), which functions as the specific electron donor to MsrP .

In this system, YedZ plays the crucial role of transmembrane electron transfer, receiving electrons from cytoplasmic donors and transferring them to the periplasmic MsrP protein. This electron transfer enables MsrP to reduce oxidized methionine residues in periplasmic proteins, restoring their functionality and contributing to protein quality control in the bacterial periplasm .

Electron Transfer Properties

YedZ has been characterized as a member of the FRD superfamily of heme-containing membrane proteins, which includes the NADPH oxidase (NOX/DUOX) proteins found in eukaryotes . Recent research has identified the Escherichia coli flavin reductase Fre as an efficient cytosolic electron donor to the heme moieties of YedZ. This interaction between Fre and YedZ has been confirmed through cross-linking experiments and surface plasmon resonance, which demonstrated that these proteins form a specific complex .

The identification of this interaction represents a significant advancement in understanding the electron transfer pathway involving YedZ. The Fre protein is related to the dehydrogenase domain of eukaryotic NOX enzymes, further supporting the relationship between bacterial YedZ-containing systems and eukaryotic NOX proteins .

Expression and Purification

Recombinant YedZ protein can be successfully expressed in Escherichia coli expression systems. Typically, the protein is produced with an N-terminal histidine tag to facilitate purification . The expression of membrane proteins like YedZ presents significant challenges due to their hydrophobic nature and tendency to aggregate. Researchers have developed optimized conditions for the overexpression and membrane solubilization of YedZ, including the use of YedZ-GFP fusion proteins to monitor expression and purification .

The purification scheme for recombinant YedZ typically involves affinity chromatography utilizing the histidine tag, followed by additional purification steps as needed to achieve high purity. The final product is often provided as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE analysis .

Physical and Chemical Properties

Table 1: Physical and Chemical Properties of Recombinant YedZ Protein

PropertySpecification
Molecular WeightApproximately 23 kDa (without tags)
Amino Acid Length211 amino acids (full length)
Expression SystemE. coli
Purification TagN-terminal His tag
FormLyophilized powder
Purity>90% (by SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Recommended Storage-20°C to -80°C
StabilityAvoid repeated freeze-thaw cycles

The recombinant YedZ protein is typically reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, the addition of 5-50% glycerol (final concentration) and storage at -20°C to -80°C is recommended to maintain protein integrity and function .

Distribution Across Species

YedZ homologues have been identified in various bacterial species and animals but are notably absent from Archaea and other eukaryotic kingdoms . This distribution pattern suggests a specific evolutionary history and functional specialization for this protein family. Within bacterial species, YedZ proteins maintain a high degree of conservation in the transmembrane domains, particularly in the histidine residues involved in heme binding .

The presence of YedZ homologues in magnetotactic bacteria and cyanobacteria is particularly noteworthy. In these organisms, YedZ domains are sometimes found fused to transport and electron transfer proteins, suggesting an expanded functional role in these specialized bacterial species .

Mammalian Homologues

Among animal homologues of YedZ, one significant example is the 6-transmembrane epithelial plasma membrane antigen of the prostate (STAMP1), which has been found to be overexpressed in prostate cancer . This connection suggests potential medical relevance for understanding YedZ structure and function.

Animal homologues typically have YedZ domains fused C-terminal to homologues of coenzyme F420-dependent NADP oxidoreductases, representing a different architectural arrangement compared to some bacterial variants . This domain organization may reflect functional adaptations specific to animal cellular environments and metabolic requirements.

YedZ as a Model for NOX-like Systems

Recent research has established that YedZ, together with its partner proteins, represents the first identified prokaryotic two-component protein system related to the eukaryotic NOX family . This discovery has significant implications for understanding the evolution of redox systems across different domains of life.

The YedZ-containing MsrPQ system provides a valuable model for studying transmembrane electron transfer mechanisms and the repair of oxidatively damaged proteins. The similarity to eukaryotic NOX systems makes YedZ an important subject for comparative biochemical studies that may illuminate the fundamental principles of biological electron transfer .

Potential Biotechnological Applications

The ability of YedZ to function as a heme-binding transmembrane electron transfer protein suggests potential applications in biotechnology, particularly in the development of biological electron transfer systems or biosensors. The protein's role in redox chemistry and its ability to interact with specific electron donors and acceptors could be exploited in engineered biological systems designed for specific redox reactions .

Additionally, the connection between animal YedZ homologues and prostate cancer suggests potential medical applications. Understanding the structure and function of YedZ may provide insights into the role of its homologues in disease processes, potentially leading to new diagnostic or therapeutic approaches .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
msrQ; YPTB3569; Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ; Flavocytochrome MsrQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Yersinia pseudotuberculosis serotype I (strain IP32953)
Target Names
msrQ
Target Protein Sequence
MRLSLRHITWLKIAIWLAATLPLLWLVLSINLGGLSADPAKDIQHFTGRMALKLLLATLL VSPLARYSKQPLLLRCRRLLGLWCFAWGTLHLLSYSILELGLSNIGLLGHELINRPYLTL GIISWLVLLALALTSTRWAQRKMGARWQKLHNWVYVVAILAPIHYLWSVKTLSPWPIIYA VMAALLLLLRYKLLLPRYKKFRQWFR
Uniprot No.

Target Background

Function
YedZ is a component of the MsrPQ system, which repairs oxidized periplasmic proteins containing methionine sulfoxide residues (Met-O) using respiratory chain electrons. This protects these proteins from oxidative stress damage caused by reactive oxygen and chlorine species generated by host defense mechanisms. MsrPQ is crucial for maintaining envelope integrity under bleach stress, rescuing numerous structurally diverse periplasmic proteins from methionine oxidation. MsrQ facilitates electron reduction to the reductase catalytic subunit MsrP, utilizing the quinone pool of the respiratory chain.
Database Links
Protein Families
MsrQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YedZ and what is its biological role in bacterial systems?

YedZ, also known as MsrQ (Protein-methionine-sulfoxide reductase heme-binding subunit MsrQ or Flavocytochrome MsrQ), is a transmembrane protein that functions as part of the MsrPQ system in bacteria. This system repairs oxidized periplasmic proteins containing methionine sulfoxide residues (Met-O) using respiratory chain electrons .

The biological significance of YedZ lies in its protective function against oxidative stress damage caused by reactive oxygen and chlorine species generated during host defense mechanisms. Within the MsrPQ system, YedZ specifically provides electrons for reduction to the reductase catalytic subunit MsrP, utilizing the quinone pool of the respiratory chain . This system is critical for maintaining envelope integrity under oxidative stress conditions, particularly bleach stress, by rescuing various structurally unrelated periplasmic proteins from methionine oxidation damage.

How does the structure of YedZ contribute to its function in electron transfer?

YedZ is a transmembrane heme-binding protein with distinctive structural features that facilitate its electron transfer function. Based on available sequence data from multiple species, the protein typically contains multiple transmembrane domains that anchor it within the bacterial membrane, strategically positioning it to interact with both respiratory chain components and its partner protein MsrP.

Comparative analysis of YedZ from different species reveals similar structural organization despite sequence variations:

SpeciesProtein LengthUniProt IDKey Structural Features
Enterobacter sp.199 aaA4WF68Contains transmembrane regions and heme-binding motifs
Escherichia coli211 aaB6I117Similar core structure with extended C-terminus
Pseudomonas putida203 aaB0KHT9Maintains conserved heme-binding residues
Shigella dysenteriaeNot specifiedQ32HK6Likely similar to E. coli homolog

The heme-binding capacity is essential for YedZ's electron transfer function. The protein's structure enables it to accept electrons from the respiratory chain quinone pool and transfer them to MsrP, which then utilizes these electrons to reduce oxidized methionine residues in periplasmic proteins. The specific arrangement of transmembrane helices creates a favorable environment for heme coordination and subsequent electron transfer.

How does YedZ gene expression change under different environmental conditions?

While the search results don't directly address the regulation of YedZ expression, we can infer from its function that its expression likely responds to oxidative stress conditions. The MsrPQ system protects against oxidative damage, suggesting that YedZ expression might be upregulated under conditions that generate reactive oxygen species (ROS) or reactive chlorine species.

To study YedZ expression changes experimentally, researchers should consider:

  • qRT-PCR analysis of yedZ/msrQ transcript levels under various stress conditions (oxidative stress, antibiotic exposure, pH shifts, temperature changes)

  • Reporter gene fusions (e.g., yedZ promoter-GFP) to monitor expression in real-time

  • Western blot analysis using anti-YedZ antibodies to quantify protein levels across different growth phases and stress conditions

  • Chromatin immunoprecipitation (ChIP) to identify transcription factors that bind to the yedZ promoter

  • RNA-seq analysis to place YedZ regulation within the broader context of the bacterial stress response network

Understanding the regulation of YedZ expression could provide insights into how bacteria prioritize different defense mechanisms under various environmental challenges.

What are the optimal conditions for expressing and purifying recombinant YedZ protein?

Based on the available research data, the following protocol represents the optimal approach for expressing and purifying functional recombinant YedZ:

  • Expression system:

    • Host: E. coli is the preferred expression host

    • Vector: pET-based vectors with N-terminal His-tag for purification

    • Induction: IPTG induction at lower temperatures (16-20°C) to enhance proper folding

  • Culture conditions:

    • Media: Terrific Broth supplemented with δ-aminolevulinic acid (50-100 μM) to enhance heme incorporation

    • Growth phase: Induce at mid-log phase (OD600 ~0.6-0.8)

    • Duration: Extended expression period (16-24 hours) at reduced temperature

  • Harvesting and lysis:

    • Cell disruption: Gentle methods like sonication with cooling intervals

    • Buffer: Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • Protease inhibitors: Add complete protease inhibitor cocktail

  • Purification:

    • Immobilized metal affinity chromatography (IMAC) using the His-tag

    • Size exclusion chromatography to ensure monodispersity

    • Detergent: Use mild detergents (DDM or LMNG) for extraction and purification

  • Storage:

    • Short-term: Store working aliquots at 4°C for up to one week

    • Long-term: Store at -20°C/-80°C with 50% glycerol to prevent freezing damage

    • Avoid repeated freeze-thaw cycles

  • Quality control:

    • Purity: SDS-PAGE analysis should show >90% purity

    • Functionality: Spectroscopic analysis to confirm proper heme incorporation

    • Homogeneity: Dynamic light scattering to verify monodispersity

This optimized protocol incorporates best practices from multiple sources and addresses the specific challenges of membrane protein expression and purification.

What methods are most effective for studying YedZ-MsrP protein interactions?

Investigating YedZ-MsrP interactions requires specialized approaches suitable for membrane protein complexes. The following methodologies are particularly effective:

  • Co-purification approaches:

    • Tandem affinity purification using differentially tagged YedZ and MsrP

    • Chemical crosslinking followed by mass spectrometry to identify interaction interfaces

    • Native PAGE analysis to preserve physiologically relevant complexes

  • Biophysical interaction studies:

    • Microscale thermophoresis (MST) for quantitative binding affinity measurements

    • Surface plasmon resonance (SPR) with captured YedZ or MsrP to determine kinetic parameters

    • Isothermal titration calorimetry (ITC) for thermodynamic characterization of the interaction

  • Structural analysis methods:

    • Cryo-electron microscopy of the reconstituted complex

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

    • Disulfide crosslinking of introduced cysteine residues to validate structural models

  • Functional assays:

    • Electron transfer assays using quinone analogs and artificial electron acceptors

    • Methionine sulfoxide reduction activity measurements with reconstituted systems

    • Oxygen consumption measurements in proteoliposomes containing both proteins

  • In vivo interaction studies:

    • Bacterial two-hybrid assays adapted for membrane proteins

    • Split-GFP complementation to visualize interactions in bacterial cells

    • Co-immunoprecipitation from bacterial membranes using specific antibodies

When designing these experiments, it's critical to consider the membrane environment, as detergents or lipid compositions can significantly influence protein-protein interactions for membrane proteins like YedZ.

How can researchers assess YedZ heme incorporation and redox activity?

Proper assessment of YedZ heme incorporation and redox activity is crucial for functional studies. The following methodological approaches provide complementary information:

  • Spectroscopic analysis of heme incorporation:

    • UV-visible spectroscopy: Characteristic Soret band (~410 nm) and α/β bands (500-600 nm)

    • Reduced minus oxidized difference spectra to identify characteristic peaks

    • Pyridine hemochromogen assay for quantitative determination of heme content

  • Redox potential determination:

    • Potentiometric titrations using various redox mediators

    • Protein film voltammetry on modified electrodes

    • Spectroelectrochemistry to monitor spectral changes during redox transitions

  • Electron transfer kinetics:

    • Stopped-flow spectroscopy with quinol substrates and electron acceptors

    • Flash photolysis to initiate rapid electron transfer reactions

    • Temperature-dependent kinetic measurements to determine activation parameters

  • Structural assessment of heme environment:

    • Resonance Raman spectroscopy to characterize heme coordination state

    • Electron paramagnetic resonance (EPR) to analyze paramagnetic heme species

    • Magnetic circular dichroism (MCD) for additional electronic structure information

  • Functional coupling assays:

    • Reconstitution with MsrP and monitoring methionine sulfoxide reduction

    • Oxygen consumption measurements in the presence of electron donors

    • H2O2 production measurements to assess potential uncoupling

These methods should be applied in combination to obtain a comprehensive understanding of YedZ's heme properties and electron transfer capabilities, which are essential for its biological function in the MsrPQ system.

How do YedZ homologs differ across bacterial species, and what are the functional implications?

Comparative analysis of YedZ homologs across bacterial species reveals interesting variations that likely reflect evolutionary adaptations to different ecological niches. Based on the available sequence data from the search results, we can observe several key differences:

SpeciesSequence LengthKey Sequence FeaturesPotential Functional Implications
Enterobacter sp.199 aa MRLTAKQITWLKVILHLAGLLPFIWLFWAASQG...Contains conserved heme-binding motifs; may have specific quinone preference
Escherichia coli211 aa MRLTAKQVTWLKVSLHLAGLLPFLWLVWAINHG...Extended C-terminus may provide additional interaction surfaces
Pseudomonas putida203 aa MRYPWFRLAI FVVGCLFPAW WLYEAAMSLL...More divergent sequence suggests adaptation to different membrane environment
Shigella dysenteriaeNot specified Not provided in search resultsLikely similar to E. coli given taxonomic relationship

To investigate the functional implications of these differences, researchers should employ:

  • Heterologous expression studies:

    • Express different YedZ homologs in a common host organism

    • Measure relative efficiency in oxidative stress protection

    • Assess complementation ability in yedZ knockout strains

  • Chimeric protein analysis:

    • Create domain-swapped versions between different homologs

    • Identify regions responsible for species-specific functions

    • Map critical residues for interactions with quinones or MsrP

  • Comparative biochemical characterization:

    • Determine redox potentials of different homologs

    • Measure electron transfer rates with various quinone types

    • Assess relative stability under different stress conditions

  • Phylogenetic analysis correlated with ecological niches:

    • Map YedZ sequence variations to bacterial lifestyle (pathogen vs. environmental)

    • Identify selective pressures driving YedZ evolution

    • Correlate sequence features with stress resistance phenotypes

These approaches would provide insights into how YedZ has evolved to optimize function in different bacterial species, potentially revealing adaptations that could be exploited for species-selective antimicrobial development.

What are the effects of specific mutations in conserved YedZ residues on MsrPQ system function?

Structure-function analysis through targeted mutagenesis provides critical insights into YedZ mechanism. While the search results don't specifically address mutagenesis studies, a comprehensive approach to this question would involve:

  • Identification of conserved residues for mutagenesis:

    • Histidine residues involved in heme coordination

    • Charged residues potentially involved in protein-protein interactions

    • Transmembrane residues important for membrane positioning

    • Residues lining potential quinone-binding sites

  • Systematic mutagenesis approaches:

    • Alanine-scanning mutagenesis of conserved regions

    • Conservative vs. non-conservative substitutions to assess specific residue properties

    • Introduction of spectroscopic probes at key positions

  • Functional assessment of mutants:

    • In vivo complementation of yedZ knockout strains under oxidative stress

    • In vitro electron transfer rates from quinols to artificial acceptors

    • Protein-protein interaction studies with MsrP using SPR or ITC

    • Heme incorporation and spectroscopic properties

  • Structural impact analysis:

    • Circular dichroism to assess secondary structure alterations

    • Thermal stability measurements of mutant proteins

    • Limited proteolysis to identify conformational changes

    • Computational modeling to predict structural perturbations

  • System-level effects:

    • Global transcriptomic/proteomic analysis in strains expressing mutant YedZ

    • Metabolomic profiling to identify metabolic changes

    • Sensitivity to various stressors beyond oxidative stress

This comprehensive mutagenesis approach would map critical functional residues in YedZ and provide mechanistic insights into how the protein contributes to the MsrPQ system function, potentially identifying targets for specific inhibition.

How does the lipid environment affect YedZ structure and function?

As a transmembrane protein, YedZ function is likely strongly influenced by its lipid environment, although the search results don't directly address this aspect. To comprehensively investigate this relationship, researchers should consider:

  • Reconstitution studies with defined lipid compositions:

    • Systematic variation of phospholipid headgroups (PE, PG, CL)

    • Alteration of acyl chain length and saturation

    • Inclusion of bacterial-specific lipids (e.g., lipid A)

  • Biophysical characterization in different lipid environments:

    • Circular dichroism to assess secondary structure changes

    • Fluorescence spectroscopy with intrinsic or extrinsic probes

    • EPR spectroscopy with site-directed spin labeling to detect conformational changes

    • Differential scanning calorimetry to measure thermal stability

  • Functional assessment across lipid compositions:

    • Electron transfer rates in different proteoliposome compositions

    • MsrP interaction studies in various membrane mimetics

    • Redox potential measurements in different lipid environments

  • Lipid-protein interaction mapping:

    • Mass spectrometry to identify tightly bound lipids

    • Molecular dynamics simulations to predict lipid binding sites

    • Site-directed mutagenesis of potential lipid-interacting residues

  • In vivo lipid modification approaches:

    • Genetic manipulation of bacterial phospholipid biosynthesis

    • Chemical inhibition of specific lipid biosynthetic enzymes

    • Correlation of membrane composition with YedZ function

Understanding the lipid-dependence of YedZ function would provide insights into how membrane composition might affect bacterial oxidative stress responses in different growth conditions or host environments, potentially revealing new approaches to modulate MsrPQ system activity.

What are the most common issues encountered in YedZ expression and purification, and how can they be resolved?

Researchers working with recombinant YedZ face several common challenges that require specific troubleshooting approaches:

  • Low expression yields:

    • Problem: As a membrane protein, YedZ often expresses poorly in standard systems

    • Solutions:

      • Use specialized expression strains (C41/C43, Lemo21)

      • Optimize codon usage for the expression host

      • Reduce expression temperature to 16-20°C

      • Try fusion partners that enhance membrane protein expression (MBP, SUMO)

  • Improper heme incorporation:

    • Problem: Recombinant YedZ may lack heme or incorporate it incorrectly

    • Solutions:

      • Supplement growth media with δ-aminolevulinic acid (ALA)

      • Co-express with heme transport systems

      • Verify heme incorporation spectroscopically

      • Reconstitute with hemin after purification if necessary

  • Protein aggregation during purification:

    • Problem: YedZ may form aggregates during extraction or purification steps

    • Solutions:

      • Screen multiple detergents systematically (DDM, LMNG, LDAO)

      • Include glycerol (5-10%) in all buffers

      • Add specific lipids that may stabilize the protein

      • Use gradient purification to separate aggregates

  • Loss of activity during storage:

    • Problem: YedZ may lose activity despite appearing stable by SDS-PAGE

    • Solutions:

      • Store in glycerol (50%) to prevent freezing damage

      • Aliquot to avoid repeated freeze-thaw cycles

      • Consider lyophilization for long-term storage

      • Verify activity before experiments with spectroscopic assays

  • Poor reconstitution into membranes:

    • Problem: YedZ may not incorporate efficiently into artificial membranes

    • Solutions:

      • Optimize lipid:protein ratios

      • Try different reconstitution methods (detergent dialysis vs. direct incorporation)

      • Use biphasic systems for difficult cases

      • Verify incorporation by gradient centrifugation

By systematically addressing these common issues using the approaches outlined above, researchers can significantly improve the success rate of YedZ expression, purification, and functional reconstitution experiments.

How can researchers troubleshoot inconsistent results in YedZ functional assays?

When facing inconsistent results in YedZ functional assays, researchers should systematically evaluate several key factors:

  • Protein quality assessment:

    • Verify purity by SDS-PAGE (should be >90% as indicated in product specifications)

    • Confirm intact protein by mass spectrometry

    • Check heme content spectroscopically (A410/A280 ratio)

    • Assess protein homogeneity by size exclusion chromatography

  • Assay component validation:

    • Test quinone substrates for oxidation or degradation

    • Verify MsrP activity independently using alternative electron donors

    • Ensure methionine sulfoxide substrates are properly oxidized

    • Check for interfering components in buffer systems

  • Environmental parameter optimization:

    • Systematic pH profiling (typically pH 6.0-8.0)

    • Temperature optimization (25-37°C range)

    • Ionic strength effects (50-300 mM salt range)

    • Oxygen level control (aerobic vs. microaerobic conditions)

  • System composition variations:

    • Lipid:protein ratios in reconstituted systems

    • Detergent effects on electron transfer

    • Protein:protein stoichiometry (YedZ:MsrP ratio)

    • Presence of additional components from expression system

  • Experimental design improvements:

    • Include internal standards for normalization

    • Perform time course measurements rather than endpoints

    • Use multiple detection methods for cross-validation

    • Implement statistical process control charts to identify drift

  • Methodological controls:

    • Positive controls with well-characterized YedZ samples

    • Negative controls with denatured or heme-free protein

    • System suitability tests before each experimental series

    • Blind sample coding to eliminate unconscious bias

By systematically addressing these factors, researchers can identify sources of variability in YedZ functional assays and implement appropriate controls and standardization procedures to obtain more consistent and reliable results.

What strategies can be employed when YedZ shows poor interaction with MsrP in reconstituted systems?

When YedZ fails to interact properly with MsrP in reconstituted systems, several strategic approaches can resolve the issue:

  • Membrane mimetic optimization:

    • Screen different detergent types and concentrations

    • Try nanodiscs with various scaffold proteins and diameters

    • Test proteoliposomes with defined lipid compositions

    • Consider styrene-maleic acid lipid particles (SMALPs) to maintain native lipid environment

  • Protein orientation control:

    • Verify correct orientation of both proteins in the membrane

    • Use oriented reconstitution techniques (e.g., His-tag directed incorporation)

    • Introduce fluorescent or paramagnetic probes to confirm orientation

    • Employ asymmetric proteoliposomes to mimic natural membrane asymmetry

  • Binding conditions modification:

    • Adjust protein:protein ratios systematically

    • Test different buffer compositions and ionic strengths

    • Vary pH to identify optimal interaction conditions

    • Consider the redox state of both proteins during interaction

  • Fusion protein approaches:

    • Create artificial YedZ-MsrP fusion proteins with flexible linkers

    • Design constructs that maintain natural topology of both proteins

    • Verify that fusion proteins retain individual activities

    • Use as positive controls to validate interaction conditions

  • Stabilizing factors addition:

    • Add specific lipids known to mediate protein-protein interactions

    • Try crowding agents to mimic cellular environment

    • Include chemical chaperones to stabilize native conformations

    • Test small molecules that might enhance interaction

  • Alternative detection methods:

    • Use proximity-based methods (FRET, BRET) with labeled proteins

    • Apply crosslinking approaches to capture transient interactions

    • Employ surface techniques (SPR, BLI) with controlled immobilization

    • Implement split reporter systems for in vitro interaction verification

By systematically exploring these strategies, researchers can identify and optimize conditions that promote productive YedZ-MsrP interactions in reconstituted systems, enabling more reliable functional studies of the MsrPQ complex.

How might YedZ research contribute to understanding bacterial antibiotic resistance mechanisms?

The MsrPQ system's role in protecting bacteria against oxidative stress has significant implications for antibiotic resistance research, offering several promising investigative avenues:

  • Connection to antibiotic-induced oxidative stress:

    • Many bactericidal antibiotics induce oxidative stress as part of their killing mechanism

    • YedZ/MsrPQ may represent an underexplored resistance mechanism

    • Systematic studies correlating YedZ expression levels with antibiotic susceptibility

    • Investigation of YedZ upregulation in response to sub-lethal antibiotic exposure

  • Persistent infection mechanisms:

    • The MsrPQ system's protection of periplasmic proteins may contribute to bacterial persistence

    • YedZ function could enable survival during antibiotic treatment by maintaining envelope integrity

    • Exploration of YedZ role in persister cell formation and antibiotic tolerance

    • Development of assays to measure YedZ activity in persister populations

  • Biofilm-associated resistance:

    • Oxidative stress is elevated in biofilm environments

    • YedZ might play a specialized role in biofilm-associated antibiotic resistance

    • Comparison of YedZ expression and function in planktonic versus biofilm growth

    • Assessment of anti-biofilm treatments in combination with YedZ inhibition

  • Host-pathogen interaction dynamics:

    • YedZ protects against immune-generated oxidative burst

    • This protection may enable evasion of host defenses during infection

    • Investigation of YedZ contribution to intracellular survival

    • Study of synergy between host defense mechanisms and antibiotic treatment

  • Therapeutic strategy development:

    • YedZ inhibitors could potentially sensitize bacteria to both antibiotics and host defenses

    • Exploration of combination therapies targeting both YedZ and primary antibiotic targets

    • High-throughput screening for YedZ inhibitors using functional assays

    • Validation of YedZ as an adjuvant target for existing antibiotics

This research direction could reveal new strategies to combat antibiotic resistance by targeting bacterial stress response systems, potentially revitalizing existing antibiotics by preventing adaptive resistance mechanisms.

What emerging technologies could advance our understanding of YedZ structure-function relationships?

Several cutting-edge technologies show particular promise for advancing YedZ research:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy for structure determination without crystallization

    • Microcrystal electron diffraction (MicroED) for structure from nanocrystals

    • Integrative structural biology combining multiple data sources

    • Time-resolved structural methods to capture conformational changes during function

  • Single-molecule techniques:

    • Single-molecule FRET to track conformational dynamics during electron transfer

    • Force spectroscopy to probe mechanical stability and unfolding pathways

    • Single-molecule electrophysiology to measure electron transfer events

    • Super-resolution microscopy to visualize YedZ distribution and clustering in membranes

  • Advanced spectroscopy:

    • Two-dimensional electronic spectroscopy for energy transfer pathways

    • Ultrafast transient absorption spectroscopy to track electron transfer kinetics

    • Pulse electron paramagnetic resonance for detailed electronic structure

    • Nuclear resonance vibrational spectroscopy for heme dynamics

  • Computational approaches:

    • Enhanced sampling molecular dynamics simulations of membrane-embedded YedZ

    • Quantum mechanics/molecular mechanics (QM/MM) for electron transfer modeling

    • Machine learning for prediction of functional sites and interaction partners

    • Systems biology modeling of YedZ within oxidative stress response networks

  • Genome engineering and high-throughput screening:

    • CRISPR-based screening to identify genetic interactions with yedZ

    • Deep mutational scanning to comprehensively map functional residues

    • Directed evolution to identify optimized or specialized YedZ variants

    • Synthetic biology approaches to create minimal MsrPQ systems with defined components

These emerging technologies could provide unprecedented insights into how YedZ structure facilitates its electron transfer function, how it interacts with other components of the MsrPQ system, and how these interactions could be modified for research or therapeutic purposes.

How might comparative analysis of YedZ across pathogenic and non-pathogenic bacteria inform antimicrobial development?

Comparative analysis of YedZ across bacterial species represents a valuable approach for antimicrobial development, with several strategic research directions:

  • Structure-function divergence mapping:

    • Detailed sequence comparison across pathogenic and non-pathogenic species

    • Identification of pathogen-specific sequence motifs or structural elements

    • Correlation of sequence variations with pathogenicity phenotypes

    • Targeting pathogen-specific features for selective inhibition

  • Expression and regulation pattern analysis:

    • Comparison of yedZ gene context and regulatory elements across species

    • Investigation of expression patterns during infection versus environmental growth

    • Analysis of stress-responsive elements in yedZ promoters

    • Identification of pathogen-specific regulatory mechanisms

  • Functional specialization assessment:

    • Comparative biochemical characterization of YedZ from multiple species

    • Evaluation of substrate specificity differences (quinone preferences)

    • Analysis of interaction strength with cognate MsrP proteins

    • Investigation of functional adaptations to specific host environments

  • Host-pathogen interface studies:

    • Examination of YedZ role in response to host-specific stressors

    • Comparison of YedZ function in host-adapted versus environmental pathogens

    • Analysis of YedZ contribution to virulence in different infection models

    • Assessment of host immune recognition of YedZ-deficient bacteria

  • Inhibitor design strategy development:

    • Structure-based design targeting conserved features in pathogenic species

    • Pharmacophore modeling based on species-specific binding sites

    • Fragment-based drug discovery focused on heme pocket differences

    • Allosteric inhibitor development targeting species-specific conformational dynamics

Species GroupRepresentative YedZ FeaturesPotential Targeting Strategy
Enterobacteriaceae pathogensConserved heme-binding motifs Target shared structural elements while exploiting minor differences
Environmental bacteriaMore divergent sequences Exploit differences to avoid disrupting beneficial microbiota
Host-restricted pathogensPotential specialized adaptationsTarget adaptations specific to host environment
Antibiotic-resistant strainsPossible upregulation or modificationsCombination therapy with conventional antibiotics

This comparative approach could lead to the development of narrow-spectrum antimicrobials that selectively target pathogenic bacteria while preserving beneficial microbiota, addressing a critical need in antimicrobial therapy.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.