Recombinant Sulfur-rich protein, serovar E (srp)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
srp; crpA; Sulfur-rich protein, serovar E; 15 kDa cysteine-rich outer membrane protein; Cysteine-rich protein A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Chlamydia trachomatis
Target Names
srp
Target Protein Sequence
MSTVPVVQGAGSSNSAQDISTSSAPLTLKERISNLLSSTAFKVGLVVIGLLLVITALIFL VSAASFVNAIYLGIPAILGCVNICVGILSIEGHCSPERWILCKKVLKTSEDIIDDGQINN SNKVFTDERLNAMDGVVESLSRRNSLVDQTQ
Uniprot No.

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Sulfur-rich protein, serovar E (srp) and what are its fundamental characteristics?

Recombinant Sulfur-rich protein, serovar E (srp) belongs to a class of proteins characterized by their high sulfur content, typically expressed through recombinant DNA technology. These proteins contain a higher-than-average number of sulfur-containing amino acids (cysteine and methionine) that form disulfide bridges critical for structural stability and function. The serovar E designation indicates it originates from a specific antigenic variant strain.

The protein can be expressed in various host systems with each offering distinct advantages. E. coli and yeast expression systems generally provide the highest yields with shorter production times, while more complex expression systems like insect and mammalian cells offer superior post-translational modifications necessary for proper protein folding and activity retention .

Which expression systems are most efficient for laboratory-scale production of Recombinant Sulfur-rich protein?

The selection of an appropriate expression system depends on research objectives, required protein characteristics, and available laboratory resources. Based on current evidence:

  • E. coli expression systems: Offer the best yields and shortest turnaround times for basic structural studies. Standard laboratory strains like BL21(DE3) can achieve approximately 10% holo-protein expression without optimization .

  • Yeast expression systems: Provide a good balance between bacterial simplicity and eukaryotic post-translational capabilities, also offering high yields and relatively short turnaround times .

  • Insect cell/baculovirus systems: More complex but deliver proper post-translational modifications necessary for correct protein folding, especially important for structural studies .

  • Mammalian cell systems: The most complex, but can provide the complete array of post-translational modifications necessary to retain full protein activity for functional studies .

For most academic research purposes, the E. coli system remains the starting point due to its established protocols and cost-effectiveness, with specialized strains like Nissle 1917 showing particular promise for enhanced cofactor incorporation .

What are the key challenges in recombinant protein expression that researchers should anticipate?

When expressing Recombinant Sulfur-rich protein, serovar E (srp), researchers commonly encounter several challenges that require methodological solutions:

  • Limited solubility: High sulfur content can lead to improper folding and inclusion body formation. This can be addressed through optimization of induction conditions (temperature, inducer concentration) and the use of solubility-enhancing fusion tags.

  • Insufficient cofactor incorporation: When the protein requires specific cofactors, standard expression systems may produce incompletely assembled proteins. For instance, conventional E. coli systems achieve only approximately 10% holo-protein for certain sulfur-containing proteins .

  • Post-translational modifications: Standard bacterial systems lack the machinery for eukaryotic-type modifications. For research requiring native-like modifications, specialized expression systems are necessary, with mammalian cells providing the most complete modification profile .

  • Protein instability: Sulfur-rich proteins may be prone to oxidation during expression and purification. Working under reducing conditions with appropriate buffer systems containing reducing agents like DTT is essential.

  • Low yields: Optimizing production parameters including growth media composition, induction timing, and environmental conditions (like simulated microgravity) can significantly enhance yields, with studies showing up to 52.4% increase in protein expression efficiency under optimized conditions .

How can simulated microgravity conditions enhance recombinant protein production?

Simulated microgravity (SMG) represents an innovative approach to enhancing recombinant protein production. Research demonstrates that SMG conditions can significantly improve yields through multiple molecular mechanisms:

  • Transcriptomic changes: SMG induces upregulation of ribosome-related genes and RNA polymerase genes including rplO, rpsK, rplV, rplP, rpsD, rplR, rpsC, rpsE, rplB, rpoA, rpoB, rpoC, and rpoZ. This transcriptional enhancement increases protein synthesis rates .

  • Enhanced plasmid copy number: Under SMG conditions, plasmid copy number increases significantly compared to normal gravity (NG), directly contributing to higher protein expression capacity .

  • Improved protein folding: Proteomic analysis reveals upregulation of chaperones and other protein folding modulators under SMG, facilitating proper folding of recombinant proteins .

  • Strengthened protein export: Both transcriptomic and proteomic analyses confirm enhanced protein export pathways under SMG conditions .

Quantitative data demonstrates that pGUS (β-glucuronidase) expression efficiency increases by 15.3%, 48.2%, and 52.4% at induction temperatures of 17°C, 27°C, and 37°C respectively under SMG compared to NG . Implementation of SMG can be achieved using specialized equipment such as High Aspect Ratio Vessels (HARVs) with optimized rotary speeds between 10-30 rpm .

What methodological approaches can overcome cofactor incorporation limitations in E. coli expression systems?

Cofactor incorporation represents a significant challenge when expressing complex proteins like Recombinant Sulfur-rich protein in standard E. coli systems. Several methodological approaches can address this limitation:

  • Specialized E. coli strains: The apathogenic E. coli strain Nissle 1917 (EcN) offers significant advantages over laboratory strains for proteins requiring cofactors. This strain possesses the heme receptor ChuA, enabling uptake of heme from the environment, resulting in quantitative incorporation of cofactors when supplied in the growth medium .

  • Post-expression reconstitution: For proteins with iron-sulfur clusters or other cofactors, reconstitution after expression but prior to purification can be effective. This involves incubating the bacterial cell-free extract with the required cofactor (such as hemin for heme proteins), followed by affinity chromatography .

  • In vitro cluster reconstitution: For sulfur-rich proteins requiring iron-sulfur clusters, incubation with excess Fe²⁺ and sulfide in the presence of reducing agents like DTT can successfully reconstitute the active cluster. This approach restored approximately 50% of the total apo-protein to holo-form in studies with [3Fe-4S] cluster-containing proteins .

  • Coexpression systems: Simultaneous expression of the target protein alongside genes involved in cofactor synthesis can enhance incorporation rates.

Comparative spectroscopic analyses (UV-vis, resonance Raman) demonstrate that the method employed significantly influences cofactor coordination, with the specialized strain approach typically providing the most native-like configuration .

What experimental parameters should be optimized for maximum yield of Recombinant Sulfur-rich protein?

Optimization of experimental parameters is crucial for maximizing yield and quality of Recombinant Sulfur-rich protein. Based on empirical research, the following parameters should be systematically optimized:

The optimal combination of these parameters must be determined empirically for each specific protein variant, with a systematic Design of Experiments (DoE) approach recommended for efficient optimization.

How do sulfur-containing clusters contribute to the structure and function of recombinant proteins?

Sulfur-containing clusters, particularly iron-sulfur ([Fe-S]) clusters, play critical roles in the structure and function of many recombinant proteins, including sulfur-rich proteins. These clusters contribute through several mechanisms:

  • Electron transfer: [Fe-S] clusters serve as efficient electron transfer centers due to their variable oxidation states. In [3Fe-4S] clusters, the iron atoms can cycle between oxidation states, facilitating electron transport chains essential for protein function .

  • Catalytic activity: These clusters often form the active site for enzymatic reactions, particularly in sulfur transfer processes. For example, the [3Fe-4S] cluster in sulfur insertion enzymes catalyzes reactions essential for tRNA thiolation .

  • Structural stability: Coordination of [Fe-S] clusters involves multiple protein ligands, creating a structural framework that stabilizes tertiary structure. Spectroscopic analysis confirms that proper incorporation of these clusters is essential for achieving native protein conformation .

  • Redox sensing: The redox state of clusters like [3Fe-4S]¹⁺ can regulate protein activity, as demonstrated in kinase modules where the oxidation state of the iron controls autophosphorylation activity .

Characterization of these clusters typically employs multiple spectroscopic techniques:

  • Electron Paramagnetic Resonance (EPR) spectroscopy reveals peaks centered at g~2.01, characteristic of oxidized [3Fe-4S]¹⁺ clusters

  • Mössbauer spectroscopy can distinguish cluster types, with [3Fe-4S] clusters displaying quadrupole doublets with δ = 0.29 mm·s⁻¹ and |ΔEQ| = 0.58 mm·s⁻¹

  • UV-visible spectroscopy shows characteristic absorption peaks around 420 nm

The functional importance of these clusters is demonstrated by activity restoration experiments, where reconstitution of [3Fe-4S] clusters restores catalytic activity in apo-proteins .

What analytical techniques are most informative for characterizing the structure of Recombinant Sulfur-rich protein?

Comprehensive structural characterization of Recombinant Sulfur-rich protein requires a multi-technique approach to elucidate different aspects of protein structure:

  • Spectroscopic methods:

    • UV-visible spectroscopy: Provides initial confirmation of cofactor incorporation, with [3Fe-4S] clusters showing characteristic absorption around 420 nm .

    • Electron Paramagnetic Resonance (EPR): Essential for characterizing paramagnetic species like [3Fe-4S]¹⁺ clusters, displaying peaks at g~2.01 .

    • Mössbauer spectroscopy: Provides detailed information about iron-containing clusters, distinguishing between different cluster types through characteristic parameters (δ and ΔEQ) .

    • Resonance Raman spectroscopy: Identifies vibrational modes of cofactors and their protein environment, revealing coordination structure .

    • Magnetic Circular Dichroism (MCD): Detects electronic transitions in paramagnetic centers, providing information about spin states .

  • Structural biology techniques:

    • X-ray crystallography: Provides atomic-resolution structures when high-quality crystals can be obtained.

    • Cryo-electron microscopy: Increasingly useful for proteins resistant to crystallization.

    • NMR spectroscopy: Valuable for solution structures and dynamics of smaller protein domains.

  • Biochemical and biophysical methods:

    • Chemical analysis of iron content: Quantifies metal incorporation, with typical [3Fe-4S] clusters containing 1.0 ± 0.1 Fe per protomer .

    • Thermal shift assays: Assess protein stability under various conditions.

    • Size-exclusion chromatography with multi-angle light scattering: Determines oligomeric state and homogeneity.

  • Functional characterization:

    • Activity assays: Correlate structural features with function, such as tRNA thiolation activity for proteins containing [3Fe-4S] clusters .

    • Redox potential measurements: Determine the electrochemical properties of redox-active clusters.

The complementary information from these techniques provides a comprehensive structural characterization, with spectroscopic methods being particularly informative for sulfur-rich proteins containing [Fe-S] clusters.

How can researchers distinguish between proper and improper folding of Recombinant Sulfur-rich protein?

Distinguishing between properly and improperly folded Recombinant Sulfur-rich protein is critical for ensuring functional studies use correctly structured protein. Multiple complementary approaches can be employed:

  • Spectroscopic analysis:

    • UV-visible spectroscopy: Properly folded proteins with [Fe-S] clusters show characteristic absorption peaks around 420 nm. Alterations in peak position or intensity can indicate improper cofactor incorporation or protein folding .

    • Circular Dichroism (CD): Provides information about secondary structure content, with properly folded proteins showing characteristic spectra corresponding to their predicted secondary structure elements.

    • Fluorescence spectroscopy: Intrinsic tryptophan fluorescence is sensitive to the local environment, providing information about tertiary structure.

  • Functional assays:

    • Enzyme activity measurements: Properly folded proteins retain catalytic activity. For example, correct folding of tRNA thiolation enzymes can be confirmed by measuring their ability to catalyze specific thiolation reactions .

    • Ligand binding assays: Correctly folded proteins should bind their natural ligands with expected affinity.

  • Structural homogeneity assessment:

    • Size-exclusion chromatography: Properly folded proteins typically show a single, symmetrical peak, while improperly folded variants often display heterogeneity or aggregation.

    • Dynamic light scattering: Provides information about size distribution and potential aggregation.

  • Stability analysis:

    • Thermal shift assays: Properly folded proteins typically show cooperative unfolding with a defined melting temperature.

    • Limited proteolysis: Correctly folded proteins often show resistance to proteolytic degradation compared to misfolded variants.

  • Expression system influence:

    • Comparative analysis of protein expressed in different systems can reveal folding differences, with specialized systems like EcN providing more native-like coordination structures for cofactor-containing proteins compared to post-expression reconstitution methods .

Researchers should employ multiple methods when evaluating protein folding, as each technique provides complementary information about different aspects of protein structure.

What approaches can resolve conflicting spectroscopic data when characterizing Recombinant Sulfur-rich protein?

When characterizing Recombinant Sulfur-rich protein, researchers sometimes encounter conflicting spectroscopic data that requires methodological resolution:

  • Multi-technique cross-validation: Employ complementary spectroscopic techniques to verify structural features. For example, when UV-visible spectroscopy suggests the presence of a [3Fe-4S] cluster (absorption peak ~420 nm), confirm with EPR (showing peaks at g~2.01) and Mössbauer spectroscopy (characteristic parameters δ = 0.29 mm·s⁻¹ and |ΔEQ| = 0.58 mm·s⁻¹) .

  • Expression method evaluation: Different expression and purification methods can produce proteins with varying cofactor incorporation and coordination structures. Systematic comparison of proteins produced via different methods can identify the source of spectroscopic heterogeneity. For example, research has shown that proteins reconstituted post-expression may display a mixture of heme iron spin states and coordination structures, while proteins expressed in specialized systems show more homogeneous spectra .

  • Controlled redox state experiments: For proteins containing redox-active centers, spectroscopic measurements under defined redox conditions can distinguish intrinsic heterogeneity from redox-dependent changes. This approach revealed that the active form of [3Fe-4S] clusters during catalysis differs from the resting state .

  • Temperature-dependent spectroscopy: Collecting data at multiple temperatures (e.g., 7K vs 80K for EPR) can resolve overlapping signals and distinguish between different species .

  • Isotopic labeling: Selective incorporation of isotopes (e.g., ⁵⁷Fe for Mössbauer spectroscopy) can provide element-specific insights to resolve conflicting data .

  • Protein variant analysis: Creating variants with strategic mutations in potential ligand residues can help assign conflicting spectroscopic features to specific structural elements.

  • Computational modeling: Quantum mechanical/molecular mechanical (QM/MM) calculations can predict spectroscopic parameters for different structural models, helping to interpret experimental data.

These approaches should be applied systematically to resolve conflicting data, with the understanding that apparent conflicts may reveal important insights about protein heterogeneity or dynamic structural features.

How can transcriptomic and proteomic analyses enhance our understanding of recombinant protein expression mechanisms?

Multi-omics approaches provide comprehensive insights into the complex cellular adaptations during recombinant protein expression. Integration of transcriptomic and proteomic data reveals:

  • Coordinated cellular response mechanisms: Combined analysis identifies correlated changes across multiple cellular systems. For example, under simulated microgravity (SMG), upregulation of ribosomal genes at the transcriptome level corresponds with increased chaperone expression at the proteome level, revealing a coordinated cellular strategy to enhance protein synthesis and proper folding .

  • Regulatory network identification: Transcriptomic data can identify transcription factors and regulatory elements controlling expression, while proteomic data confirms which transcriptional changes result in actual protein-level alterations.

  • Bottleneck identification: By comparing transcriptomic and proteomic profiles, researchers can identify rate-limiting steps in protein production. For instance, transcriptional upregulation without corresponding protein increases may indicate post-transcriptional limitations .

  • Environmental adaptation mechanisms: Multi-omics analysis under varying conditions (e.g., SMG vs. normal gravity) reveals how cells reprogram their metabolism to optimize protein production. SMG studies demonstrated upregulation of energy metabolism genes at the transcriptomic level while simultaneously enhancing protein folding modulators at the proteomic level .

  • Strain engineering targets: Identifying genes differentially expressed across the transcriptome and proteome provides rational targets for strain optimization.

Methodologically, this requires:

  • RNA-seq for transcriptomic profiling, with cells cultured under identical conditions to protein expression experiments

  • Quantitative proteomics using techniques like bicinchoninic acid assay for total protein determination

  • Sophisticated bioinformatic analysis to integrate datasets, identifying both concordant and discordant changes between transcriptome and proteome

The power of this approach was demonstrated in SMG studies, where integrated analysis identified simultaneous enhancement of ribosome/RNA polymerase assembly, energy metabolism, protein folding, and protein export as key mechanisms driving improved recombinant protein production .

What are the most effective strategies for investigating the catalytic mechanism of Recombinant Sulfur-rich protein?

Investigating the catalytic mechanism of Recombinant Sulfur-rich protein, particularly those involving sulfur transfer reactions or [Fe-S] clusters, requires sophisticated methodological approaches:

  • Structural characterization of catalytic intermediates:

    • Rapid-freeze quenching: Captures transient reaction intermediates for spectroscopic analysis

    • Time-resolved crystallography: Provides structural snapshots during catalysis

    • Advanced EPR techniques: Pulsed EPR methods can detect short-lived radical species formed during catalysis

  • Mechanistic probes:

    • Isotope labeling: Using ³⁴S or ³⁵S can track sulfur atom transfer pathways

    • Site-directed mutagenesis: Systematic mutation of proposed catalytic residues can validate mechanistic hypotheses

    • Substrate analogs: Modified substrates can trap reaction intermediates

  • Redox state manipulation:

    • Controlled redox potential: Electrochemical methods to manipulate and measure cluster redox states

    • Chemical oxidants/reductants: To test cluster-dependent activity under different redox conditions

    • Anaerobic techniques: Essential for preserving native redox states of oxygen-sensitive [Fe-S] clusters

  • Kinetic and thermodynamic analyses:

    • Steady-state kinetics: Determines basic catalytic parameters (kcat, KM)

    • Pre-steady-state kinetics: Identifies rate-limiting steps and detects transient intermediates

    • Binding studies: Isothermal titration calorimetry or surface plasmon resonance to measure substrate/cofactor interactions

  • Computational approaches:

    • Quantum mechanical calculations: Models electronic structure of [Fe-S] clusters

    • Molecular dynamics simulations: Examines protein dynamics during catalysis

    • QM/MM hybrid methods: Combines quantum treatment of the active site with molecular mechanical treatment of the protein environment

  • Identification of protein partners:

    • Pull-down assays: Identifies protein-protein interactions in sulfur transfer pathways

    • In vivo crosslinking: Captures transient interactions within cellular context

Research on tRNA thiolation enzymes demonstrates the power of integrating these approaches, revealing that the [3Fe-4S] cluster in these enzymes establishes a direct link between ancient Fe-S chemistry and essential translation processes in archaea and eukaryotes .

What is an optimal protocol for high-yield purification of Recombinant Sulfur-rich protein from E. coli?

The following optimized protocol for high-yield purification of Recombinant Sulfur-rich protein from E. coli integrates key methodological elements from multiple research studies:

Materials Required:

  • LB medium (10 g/L tryptone, 5 g/L yeast extract, 10 g/L NaCl)

  • Appropriate antibiotics (e.g., 50 μg/ml kanamycin)

  • IPTG (isopropyl β-D-1-thiogalactopyranoside)

  • Lysis buffer: 50 mM Tris-HCl (pH 7.4), 8 M urea, 65 mM dithiothreitol, 1 mM EDTA, 1% (v/v) Triton, 1 mM PMSF, 2% (v/v) protease inhibitor cocktail, phosphatase inhibitor cocktail (1 tablet/10 ml)

  • Specialized E. coli strain (Nissle 1917 recommended for cofactor-containing proteins)

Protocol:

  • Culture Preparation:

    • Inoculate overnight bacterial culture in LB medium with appropriate antibiotics

    • Dilute (1:10) in fresh LB medium with antibiotics

    • Incubate at 37°C until OD₆₀₀ reaches 0.6-0.8

  • Protein Expression:

    • Induce with 0.8 mM IPTG

    • For standard proteins: continue incubation at 37°C for 4-6 hours

    • For proteins prone to insolubility: reduce temperature to 17-27°C and extend induction time to 8 hours

    • For cofactor-containing proteins: supplement medium with the required cofactor during induction

  • For Enhanced Yields - Simulated Microgravity (Optional):

    • Transfer culture to High Aspect Ratio Vessels (HARVs)

    • Rotate at optimized speed (20 rpm recommended)

    • This approach increases yield by up to 52.4% compared to normal gravity conditions

  • Cell Harvest and Lysis:

    • Centrifuge cultures at 5,000 × g for 15 minutes at 4°C

    • Wash cell pellet with ice-cold PBS (pH 7.2) three times

    • Resuspend in ice-cold lysis buffer

    • Lyse cells by ultrasonication in an ice bath

    • Centrifuge at 12,000 × g for 30 minutes at 4°C to remove debris

  • Protein Purification:

    • Apply clarified lysate to appropriate affinity column (based on fusion tag)

    • Wash extensively to remove non-specifically bound proteins

    • Elute protein using appropriate buffer conditions

    • For [Fe-S] cluster-containing proteins, perform all purification steps anaerobically

  • Post-Purification Processing:

    • Analyze protein concentration using bicinchoninic acid method

    • Verify purity by SDS-PAGE

    • Confirm cofactor incorporation by UV-visible spectroscopy (characteristic absorption peak at ~420 nm for [Fe-S] cluster proteins)

    • For proteins requiring reconstitution: incubate with excess Fe²⁺ and sulfide in the presence of DTT

This protocol typically yields 10-20 mg of purified protein per liter of bacterial culture, with up to 50% higher yields under optimized simulated microgravity conditions .

How can researchers troubleshoot common issues in the expression and purification of Recombinant Sulfur-rich protein?

Recombinant Sulfur-rich protein expression and purification can present numerous challenges. This comprehensive troubleshooting guide addresses common issues with evidence-based solutions:

Problem 1: Low expression levels

Potential causes and solutions:

  • Codon usage bias: Optimize codons for expression host or use specialized strains with rare tRNA genes

  • Promoter strength: Test different promoter systems (T7, tac, arabinose-inducible)

  • Growth conditions: Implement simulated microgravity (SMG), which can increase expression efficiency by up to 52.4%

  • Plasmid stability: Monitor plasmid stability throughout growth; under SMG, plasmid stability may be slightly lower than under normal gravity

  • Induction parameters: Systematically optimize inducer concentration (0.8 mM IPTG often effective) and induction temperature (test 17°C, 27°C, and 37°C)

Problem 2: Protein insolubility/inclusion body formation

Potential causes and solutions:

  • Rapid overexpression: Reduce temperature to 17-27°C and lower inducer concentration

  • Improper folding: Co-express with chaperones or use specialized strains with enhanced folding capacity

  • Missing cofactors: For [Fe-S] cluster proteins, either use specialized strains like E. coli Nissle 1917 with supplemented media or perform in vitro reconstitution with Fe²⁺ and sulfide in the presence of DTT

  • Oxidative stress: Include additional reducing agents in growth media and lysis buffers

Problem 3: Incomplete cofactor incorporation

Potential causes and solutions:

  • Limited cofactor availability: Supplement growth media with required cofactors

  • Inappropriate expression system: Standard E. coli strains achieve only ~10% holo-protein for certain cofactor-containing proteins; switch to specialized strains like E. coli Nissle 1917

  • Aerobic conditions: Perform expression and purification under anaerobic conditions for oxygen-sensitive cofactors

  • Ineffective reconstitution: Optimize in vitro reconstitution conditions; successful reconstitution of [3Fe-4S] clusters typically restores ~50% of apo-protein to holo-form

Problem 4: Heterogeneous protein product

Potential causes and solutions:

  • Multiple conformational states: Verify using spectroscopic methods; proteins reconstituted post-expression may show a mixture of spin states and coordination structures compared to those expressed in specialized systems

  • Proteolytic degradation: Include protease inhibitors in all buffers and reduce purification time

  • Incomplete post-translational modifications: Consider expression in systems capable of appropriate modifications (e.g., insect or mammalian cells for complex modifications)

  • Oxidative damage: Include reducing agents throughout purification process

Problem 5: Low activity of purified protein

Potential causes and solutions:

  • Improper folding: Confirm structural integrity using spectroscopic methods (UV-vis, EPR, Mössbauer)

  • Incorrect redox state: For redox-active proteins, carefully control the oxidation state; the active form during catalysis may differ from the resting state

  • Inhibitory contaminants: Implement additional purification steps or buffer exchange

  • Cofactor loss during purification: Maintain anaerobic conditions and include cofactor in purification buffers

This troubleshooting guide addresses the most common challenges based on experimental evidence from sulfur-rich and cofactor-containing protein research, providing methodological solutions for each issue.

What considerations are important when designing experiments to study the role of [Fe-S] clusters in Recombinant Sulfur-rich protein function?

Designing robust experiments to investigate [Fe-S] clusters in Recombinant Sulfur-rich proteins requires careful consideration of multiple factors:

  • Anaerobic techniques and sample preparation:

    • Stringent oxygen exclusion: All procedures should be conducted in an anaerobic chamber with O₂ levels < 1 ppm to prevent cluster degradation .

    • Buffer considerations: Include reducing agents like DTT to maintain cluster integrity; typical effective concentration is 5-10 mM .

    • Sample concentration: For spectroscopic techniques, protein concentrations of 0.5-1.0 mM are typically required for clear [Fe-S] cluster signals .

    • Freeze-quench methods: For capturing reaction intermediates, samples must be rapidly frozen in liquid nitrogen to preserve transient states.

  • Spectroscopic analysis design:

    • Multi-technique approach: Plan complementary methods including UV-visible (identifying absorption peaks ~420 nm), EPR (for paramagnetic species with g~2.01), and Mössbauer spectroscopy (providing parameters δ = 0.29 mm·s⁻¹ and |ΔEQ| = 0.58 mm·s⁻¹ for [3Fe-4S] clusters) .

    • Temperature conditions: EPR measurements at multiple temperatures (e.g., 7K and 80K) can distinguish between different cluster types .

    • Spin quantification: Compare EPR signal intensity with chemical analysis of Fe content to determine cluster occupancy; typical [3Fe-4S] clusters contain 1.0 ± 0.1 Fe per protomer .

  • Functional correlation experiments:

    • Structure-function relationship: Design experiments that directly correlate spectroscopic changes with functional outcomes; for example, monitoring tRNA thiolation activity alongside cluster state changes .

    • Redox manipulation: Include experiments under varying redox potentials to determine how cluster oxidation state affects activity.

    • Metal substitution: Replace Fe with spectroscopically distinct metals when possible to probe specific metal roles.

  • Genetic manipulation strategies:

    • Ligand mutation: Systematically mutate coordinating residues to assess their role in cluster binding and function.

    • Cluster biosynthesis: Consider manipulating genes involved in [Fe-S] cluster assembly to modulate cluster incorporation.

    • Heterologous expression: Compare protein expressed in different systems, particularly between standard E. coli strains and specialized strains like Nissle 1917 for comprehensive understanding .

  • Controls and validation:

    • Apo-protein controls: Generate cluster-free protein variants for activity comparison; reconstitution of [3Fe-4S] clusters should restore activity if the cluster is functional .

    • Complementary protein variants: Include related proteins with different cluster types as comparative controls.

    • Chemical validation: Use specific cluster disruptors (e.g., oxidants, metal chelators) as additional controls.

  • Data integration approach:

    • Correlation matrix: Design experiments to establish correlations between spectroscopic parameters, cluster integrity, and functional outcomes.

    • Time-dependent measurements: Include kinetic experiments to capture cluster changes during catalytic cycles.

These considerations ensure robust experimental design that can definitively establish the structural and functional roles of [Fe-S] clusters in Recombinant Sulfur-rich proteins.

What emerging technologies show promise for enhancing recombinant protein production beyond current methodologies?

Several emerging technologies hold significant promise for revolutionizing recombinant protein production, particularly for complex proteins like Recombinant Sulfur-rich protein:

  • Advanced bioreactor designs:

    • Simulated microgravity systems: Current research demonstrates SMG can enhance expression efficiency by up to 52.4% . Next-generation rotating wall vessel bioreactors with improved fluid dynamics modeling may further optimize this effect.

    • Microfluidic bioreactors: Enabling precise control of microenvironments and high-throughput optimization of expression conditions.

    • Continuous processing platforms: Moving beyond batch culture to continuous production with real-time monitoring and adjustment.

  • Synthetic biology approaches:

    • Minimal genome expression hosts: Stripped-down bacterial genomes optimized specifically for protein production with reduced metabolic burden.

    • Expanded genetic code systems: Incorporating non-canonical amino acids for enhanced protein stability or function.

    • Designer cellular compartments: Engineered microcompartments to isolate protein production from competing cellular processes.

  • CRISPR/Cas-based genome engineering:

    • Multiplex pathway optimization: Simultaneous modification of multiple genes involved in transcription, translation, folding, and cofactor biosynthesis.

    • Dynamic regulation systems: Programmable expression systems responding to cellular states for coordinated protein production.

    • CRISPRi/CRISPRa screens: High-throughput identification of rate-limiting steps in recombinant protein production.

  • Artificial intelligence integration:

    • Machine learning for strain design: Predicting optimal host genotypes for specific recombinant proteins.

    • Automated experimental design: AI-driven optimization of expression conditions beyond human-designed experiments.

    • Protein structure prediction: Enhanced computational tools to predict folding challenges and design appropriate expression strategies.

  • Novel expression systems:

    • Cell-free production platforms: Bypassing cellular limitations through optimized in vitro transcription-translation systems.

    • Specialized symbiotic systems: Co-cultures of specialized organisms for complex cofactor synthesis and incorporation.

    • Extremophile-derived expression hosts: Platforms based on organisms adapted to extreme environments that may offer advantages for difficult-to-express proteins.

  • Advanced analytical techniques:

    • Single-cell omics: Capturing cell-to-cell variability in protein production to identify super-producing phenotypes.

    • Real-time intracellular sensors: Non-invasive monitoring of folding state and cofactor incorporation during expression.

    • In-line quality assessment: Continuous monitoring technologies for rapid feedback on protein quality.

These emerging technologies build upon current understanding of protein expression mechanisms, such as the transcriptomic and proteomic changes observed under SMG , while offering transformative potential to overcome existing limitations in recombinant protein production.

How might advances in computational modeling inform the optimization of Recombinant Sulfur-rich protein expression and function?

Computational modeling is rapidly transforming recombinant protein research, with particular relevance for complex proteins like Recombinant Sulfur-rich protein:

  • Sequence-based prediction and optimization:

    • Codon optimization algorithms: Advanced models now incorporate translation elongation dynamics, tRNA pool availability, and mRNA secondary structure predictions to maximize expression efficiency.

    • Machine learning approaches: Deep learning models trained on large protein expression datasets can predict optimal expression conditions and host systems for specific protein sequences.

    • Signal peptide design: Computational tools can optimize secretion signal sequences for efficient protein export, addressing the upregulation of protein export pathways observed in high-yielding conditions .

  • Structural modeling and engineering:

    • AlphaFold2 and RoseTTAFold integration: These revolutionary protein structure prediction tools can model difficult-to-crystallize proteins, including those with [Fe-S] clusters.

    • Cofactor binding site optimization: Computational redesign of coordination spheres around [Fe-S] clusters can enhance stability and activity.

    • Protein dynamics simulations: Molecular dynamics approaches can identify flexible regions that might impair folding, allowing targeted stabilization.

  • Systems biology modeling:

    • Genome-scale metabolic models: Integration of transcriptomic and proteomic data with metabolic models can identify bottlenecks in cofactor synthesis and protein production.

    • Regulatory network inference: Machine learning algorithms can predict how environmental perturbations (like simulated microgravity) remodel gene expression networks.

    • Flux balance analysis: Predicting optimal media formulations and feeding strategies to maximize precursor availability for recombinant protein synthesis.

  • Quantum mechanical modeling:

    • QM/MM approaches: Hybrid quantum mechanical/molecular mechanical simulations can model [Fe-S] cluster electronic states with unprecedented accuracy.

    • Reaction mechanism elucidation: Computational chemistry can predict transition states and energy barriers in catalytic mechanisms.

    • Spectroscopic prediction: Calculation of spectroscopic parameters (UV-vis, EPR, Mössbauer) for different cluster states aids in experimental data interpretation .

  • Integration with experimental approaches:

    • Digital twins: Creating computational models of specific expression systems that can be virtually manipulated to predict experimental outcomes.

    • Automated Design-Build-Test-Learn cycles: Computational models direct experimental design, with results feeding back to refine models.

    • Uncertainty quantification: Modern computational approaches can provide confidence intervals for predictions, guiding experimental resource allocation.

By 2025, these computational approaches are increasingly integrated with high-throughput experimental platforms, accelerating optimization cycles and enabling rational design of expression systems tailored to the unique challenges of Recombinant Sulfur-rich proteins. This computational guidance is particularly valuable for complex proteins requiring special consideration of cofactor incorporation and proper folding.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.