Recombinant Sulfurihydrogenibium azorense NADH-quinone oxidoreductase subunit K (nuoK)

What is Sulfurihydrogenibium azorense and why is it significant in research?

Sulfurihydrogenibium azorense is a thermophilic, strictly chemolithoautotrophic, microaerophilic bacterium isolated from terrestrial hot springs at Furnas, São Miguel Island, Azores, Portugal. The organism is significant for research due to its remarkable adaptations to extreme environments, with a growth temperature range of 50-73°C (optimal at 68°C) and pH tolerance between 5.5-7.0 (optimal at pH 6.0). This bacterium belongs to the Aquificales order and is closely related to Sulfurihydrogenibium subterraneum, with only 2.0% genetic distance based on 16S rRNA phylogeny . The extreme thermophilic nature of S. azorense makes its enzymes particularly valuable for biotechnological applications requiring high-temperature stability, including industrial processes and biocatalysis research. The organism's metabolic versatility is also noteworthy, as it can utilize various electron donors including elemental sulfur, sulfite, thiosulfate, ferrous iron, and hydrogen .

What is the structure and function of NADH-quinone oxidoreductase subunit K in S. azorense?

NADH-quinone oxidoreductase subunit K (nuoK) from S. azorense is a membrane protein component of the respiratory complex I (NADH:ubiquinone oxidoreductase). The protein consists of 100 amino acid residues with the sequence MVPYEYYVALSGLLMVLGFIGIVIRKNIIAMLSTELMLNAVNVAFVAFDMKLHDVVGQVFVFFILTIAAAEAAIGLGLIMAIYRMKKDVDVEKLTELKG . This hydrophobic protein is characterized by transmembrane helices that anchor it within the membrane domain of complex I. Functionally, nuoK participates in electron transport from NADH to quinone, contributing to the proton translocation mechanism that generates the proton motive force used for ATP synthesis. The protein's thermostability, inherited from its thermophilic host organism, makes it particularly interesting for studying structure-function relationships in respiratory complexes under extreme temperature conditions.

What expression systems are most effective for recombinant production of S. azorense nuoK?

For recombinant production of S. azorense NADH-quinone oxidoreductase subunit K, E. coli-based expression systems optimized for membrane proteins are generally recommended. The BL21(DE3) strain containing pET vectors with T7 promoters has shown good results for expressing thermophilic membrane proteins. When expressing S. azorense nuoK, consider these methodological approaches:

• Use expression vectors containing a C-terminal or N-terminal His-tag for purification purposes

• Include fusion partners like MBP (maltose-binding protein) or SUMO to enhance solubility

• Consider using specialized E. coli strains like C41(DE3) or C43(DE3) designed specifically for membrane protein expression

• Induction should be performed at lower temperatures (18-25°C) with reduced IPTG concentrations (0.1-0.5 mM) to promote proper folding

• Supplement growth media with specific lipids or detergents to assist in membrane protein folding

For challenging cases, cell-free expression systems may provide an alternative approach, allowing direct incorporation into liposomes or nanodiscs for functional studies.

What are the optimal storage conditions for purified recombinant S. azorense nuoK protein?

The optimal storage conditions for purified recombinant S. azorense NADH-quinone oxidoreductase subunit K are:

• Store at -20°C for short-term storage or -80°C for extended storage periods

• Use a Tris-based buffer with 50% glycerol, specifically optimized for this protein

• Avoid repeated freeze-thaw cycles, as they can compromise protein integrity

• For working aliquots, store at 4°C for up to one week

For membrane proteins like nuoK, consider these additional practices:

• Maintain proper detergent concentrations above critical micelle concentration (CMC) throughout storage

• Include reducing agents like DTT or β-mercaptoethanol (typically 1-5 mM) to prevent oxidation of cysteine residues

• Consider adding protease inhibitors to prevent degradation

• For long-term storage, flash-freezing in liquid nitrogen before transferring to -80°C may help preserve structure and function

How can researchers verify the identity and purity of recombinant S. azorense nuoK preparations?

Researchers can verify the identity and purity of recombinant S. azorense NADH-quinone oxidoreductase subunit K preparations through several complementary techniques:

• SDS-PAGE analysis: Should show a single band at approximately 11 kDa (calculated from the 100 amino acid sequence)

• Western blotting: Using antibodies against the tag (if present) or custom antibodies against nuoK

• Mass spectrometry:

  • MALDI-TOF or ESI-MS to confirm the molecular weight

  • Peptide mass fingerprinting after tryptic digestion to verify sequence identity

• N-terminal sequencing: To confirm the first 5-10 amino acids match the expected sequence (MVPYE...)

• Protein purity assessment:

  • Analytical size exclusion chromatography

  • Capillary electrophoresis

  • Dynamic light scattering to assess homogeneity

• Functional verification: Activity assays measuring electron transfer capabilities in reconstituted systems

For membrane proteins like nuoK, additional verification through circular dichroism (CD) spectroscopy can confirm proper secondary structure formation, which is crucial for functional integrity.

What structural features contribute to the thermostability of S. azorense nuoK protein?

The thermostability of S. azorense NADH-quinone oxidoreductase subunit K can be attributed to several structural features typical of proteins from thermophilic organisms:

• Amino acid composition: Analysis of the nuoK sequence (MVPYEYYVALSGLLMVLGFIGIVIRKNIIAMLSTELMLNAVNVAFVAFDMKLHDVVGQVFVFFILTIAAAEAAIGLGLIMAIYRMKKDVDVEKLTELKG) reveals:

  • Higher proportion of hydrophobic residues in transmembrane regions

  • Strategic positioning of charged residues (K, R, E) that form salt bridges

  • Reduced number of thermolabile residues (N, Q, C)

• Structural stabilization mechanisms:

  • Increased number of ion pairs and salt bridges

  • Enhanced hydrophobic core packing within transmembrane regions

  • Reduced conformational flexibility in loop regions

• Membrane environment adaptation:

  • Specialized lipid interactions that maintain stability at higher temperatures

  • Modified hydrophobic mismatch parameters compared to mesophilic counterparts

The thermostability of S. azorense proteins has been demonstrated in related enzymes, such as the S. azorense carbonic anhydrase (Saz_CA), which exhibits thermal activation at 60°C . This suggests that proteins from this organism, including nuoK, likely share adaptations for function at elevated temperatures. Computational analyses comparing nuoK with mesophilic homologs can further elucidate these thermostabilizing features.

How can researchers effectively design functional studies for S. azorense nuoK in reconstituted systems?

Designing functional studies for S. azorense NADH-quinone oxidoreductase subunit K in reconstituted systems requires careful consideration of the protein's membrane environment and thermophilic nature. A methodological approach includes:

• Membrane reconstitution strategies:

  • Proteoliposome preparation using lipids that mimic the native membrane environment

  • Incorporation into nanodiscs with appropriate scaffold proteins stable at elevated temperatures

  • Detergent-solubilized systems with thermostable detergents (DDM, LMNG)

• Electron transport chain reconstitution:

  • Co-reconstitution with other subunits of complex I for complete functional studies

  • Preparation of minimal functional units containing essential partner subunits

  • Coupling with artificial electron donors/acceptors for isolated component study

• Activity measurement protocols:

  • Spectrophotometric assays measuring NADH oxidation at elevated temperatures (50-70°C)

  • Oxygen consumption measurements using Clark-type electrodes

  • Membrane potential measurements using potential-sensitive dyes

• Temperature control considerations:

  • Design of specialized reaction chambers maintaining stable elevated temperatures

  • Temperature gradient experiments to determine optimal activity conditions

  • Thermal stability profiling to establish experimental windows

• Data analysis approaches:

  • Kinetic parameter determination at various temperatures

  • Arrhenius plot analysis to determine activation energies

  • Comparative analysis with mesophilic homologs

The thermostability of S. azorense proteins, as demonstrated by the thermal activation of Saz_CA at 60°C , suggests that functional studies of nuoK should be conducted within the organism's growth temperature range (50-73°C, optimum at 68°C) .

What are the potential applications of S. azorense nuoK in bioenergetics research?

S. azorense NADH-quinone oxidoreductase subunit K presents several valuable applications in bioenergetics research due to its thermostable properties and role in respiratory complex I:

• Model system for thermophilic energy conservation:

  • Investigation of thermal adaptation in electron transport chains

  • Comparative studies with mesophilic counterparts to understand temperature effects on bioenergetic efficiency

  • Exploration of energy conservation mechanisms at temperature extremes

• Structural biology applications:

  • Thermostable properties may facilitate crystallization for high-resolution structural studies

  • Cryo-EM analysis of thermophilic respiratory complexes

  • Structure-guided design of synthetic electron transport components

• Biotechnological applications:

  • Development of thermostable biofuel cells operating at elevated temperatures

  • Design of biomimetic electron transport systems for industrial catalysis

  • Biosensor components functioning under extreme conditions

• Fundamental research insights:

  • Probing mechanism of proton translocation in complex I under various conditions

  • Understanding evolutionary adaptations in bioenergetic systems

  • Exploration of protein-lipid interactions critical for membrane protein function

The thermal stability properties exhibited by proteins from S. azorense, as demonstrated by the carbonic anhydrase that shows thermal activation at 60°C , make nuoK particularly valuable for studying electron transport processes at elevated temperatures that would denature mesophilic proteins.

What purification strategies yield optimal results for recombinant S. azorense nuoK?

Purification of recombinant Sulfurihydrogenibium azorense NADH-quinone oxidoreductase subunit K requires specialized approaches due to its membrane protein nature and thermophilic origin. A comprehensive purification strategy includes:

• Cell lysis and membrane fraction isolation:

  • Mechanical disruption methods (French press, sonication) in buffer containing protease inhibitors

  • Differential centrifugation to isolate membrane fractions (typically 100,000×g ultracentrifugation)

  • Membrane washing steps to remove peripheral proteins

• Detergent solubilization:

  • Screen detergents (DDM, LMNG, LDAO) at 1-2% concentration for efficient extraction

  • Optimization of solubilization time (2-4 hours) and temperature (4°C or room temperature)

  • Centrifugation to remove insoluble material (100,000×g for 1 hour)

• Affinity chromatography:

  • IMAC purification using His-tag affinity if protein is tagged

  • Optimization of imidazole concentration in washing/elution buffers

  • Consider on-column detergent exchange if necessary

• Secondary purification:

  • Size exclusion chromatography for final polishing and buffer exchange

  • Ion exchange chromatography if additional purity is required

  • Validation of oligomeric state during purification

• Thermal purification advantage:

  • Heat treatment step (60°C for 10-20 minutes) to exploit thermostability for purification

  • Removal of heat-denatured contaminant proteins by centrifugation

  • Analysis of activity retention after heat treatment

This approach leverages the natural thermostability of S. azorense proteins, similar to what has been observed with Saz_CA, which can be partially purified through heat treatment and appears to be thermally activated at 60°C .

What analytical techniques are most appropriate for characterizing the enzyme kinetics of S. azorense nuoK?

Characterizing the enzyme kinetics of S. azorense NADH-quinone oxidoreductase subunit K requires specialized techniques accounting for its membrane-bound nature and thermophilic characteristics:

• Spectrophotometric assays:

  • NADH oxidation monitoring at 340 nm at elevated temperatures (50-70°C)

  • Ubiquinone/ubiquinol detection using differential wavelength approaches

  • Use of thermal-stable cuvettes or plate readers with temperature control

• Oxygen consumption measurements:

  • Clark-type or optical oxygen electrodes calibrated for high-temperature measurements

  • Sealed reaction chambers to prevent evaporation at elevated temperatures

  • Real-time data collection systems with temperature compensation

• Artificial electron acceptor assays:

  • Ferricyanide reduction assays for NADH dehydrogenase activity

  • Tetrazolium salt (NBT, INT) reduction for visualization of activity

  • Decylubiquinone or coenzyme Q analogs as defined substrates

• Membrane potential measurements:

  • Potentiometric dyes stable at high temperatures

  • Liposome-reconstituted systems with ion-selective electrodes

  • Continuous monitoring during substrate turnover

• Data analysis approaches:

  • Michaelis-Menten kinetic parameter determination at various temperatures

  • Construction of Arrhenius plots to determine activation energy

  • Effect of pH, ion concentration, and inhibitors at different temperatures

This approach accounts for the thermophilic nature of S. azorense, which grows optimally at 68°C and has a temperature range of 50-73°C , suggesting nuoK will have maximum activity within this temperature window.

How can researchers effectively study protein-protein interactions involving S. azorense nuoK within Complex I?

Studying protein-protein interactions involving S. azorense NADH-quinone oxidoreductase subunit K within Complex I requires specialized approaches that account for membrane protein characteristics and thermostability:

• Cross-linking methodologies:

  • Chemical cross-linking with MS analysis to identify interaction partners

  • Photo-activatable cross-linkers for capturing transient interactions

  • Temperature-optimized cross-linking protocols (50-70°C) to capture physiologically relevant states

• Co-purification approaches:

  • Tandem affinity purification using tagged nuoK to identify interacting partners

  • Gradient ultracentrifugation of solubilized membranes to isolate intact complexes

  • Identification of interaction partners by proteomics analysis

• Reconstitution studies:

  • Systematic co-reconstitution of purified complex I subunits

  • Activity measurements to determine minimal functional units

  • Identification of subunit interactions critical for electron transport

• Biophysical interaction analysis:

  • Surface plasmon resonance with temperature control module

  • Isothermal titration calorimetry optimized for membrane proteins

  • Microscale thermophoresis for quantifying binding affinities at elevated temperatures

• Structural biology approaches:

  • Cryo-EM analysis of intact complexes at various states

  • Computational modeling of subunit interfaces based on homologous structures

  • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

These methodologies should be conducted considering the optimal growth conditions of S. azorense (temperature range 50-73°C, optimum at 68°C, pH 5.5-7.0 with optimum at pH 6) to ensure physiologically relevant results. The demonstrated thermostability of other S. azorense enzymes, such as carbonic anhydrase which shows thermal activation at 60°C , suggests that nuoK interactions should be studied at similar elevated temperatures.

How does S. azorense nuoK compare to homologous proteins from mesophilic organisms in terms of structure and function?

Comparative analysis of S. azorense NADH-quinone oxidoreductase subunit K with mesophilic homologs reveals significant adaptations related to thermostability while maintaining core functional elements:

• Sequence comparison analysis:

  • Higher percentage of hydrophobic and charged residues in S. azorense nuoK

  • Reduced frequency of thermolabile residues (asparagine, glutamine)

  • Strategic positioning of proline residues to restrict conformational flexibility

• Structural comparison metrics:

  Feature	S. azorense nuoK	Mesophilic homologs	Functional Significance
  Transmembrane helices	Tighter packing	Looser arrangement	Enhanced thermal stability
  Loop regions	Shorter, more rigid	Longer, more flexible	Reduced unfolding at high temperatures
  Charged residues	Strategic salt bridges	Fewer ion pairs	Electrostatic stabilization
  Hydrophobic core	More extensive	Less compact	Structural integrity at high temperatures

• Functional differences:

  • Generally maintained electron transfer mechanism across temperature ranges

  • Potentially altered quinone binding parameters for function at high temperatures

  • Modified proton pumping efficiency optimized for thermophilic environments

• Evolutionary adaptation analysis:

  • Conserved functional residues across temperature ranges

  • Divergent residues primarily involved in structural stabilization

  • Evidence of convergent evolution in thermophiles from different lineages

S. azorense has been shown to thrive at temperatures between 50-73°C (optimum at 68°C) , which is reflected in the properties of its proteins. Similar to other proteins from this organism, such as the carbonic anhydrase which exhibits thermal activation at 60°C , nuoK likely contains structural adaptations that maintain functionality at these elevated temperatures while preserving the core catalytic mechanism found in mesophilic homologs.

What research protocols are recommended for investigating the thermal stability profile of S. azorense nuoK?

Investigation of the thermal stability profile of S. azorense NADH-quinone oxidoreductase subunit K requires specialized methodologies that account for its thermophilic nature and membrane protein characteristics:

• Differential Scanning Calorimetry (DSC) protocol:

  • Sample preparation: 0.5-1.0 mg/ml purified protein in detergent micelles

  • Temperature range: 20-100°C with 1°C/min scan rate

  • Multiple heating/cooling cycles to assess reversibility

  • Data analysis: determination of transition temperatures and enthalpy changes

• Circular Dichroism (CD) thermal melting protocol:

  • Far-UV CD spectra (190-260 nm) at increasing temperatures (25-95°C)

  • Real-time monitoring at 222 nm during temperature ramping

  • Analysis of secondary structure changes and calculation of melting temperature

  • Comparison with mesophilic homologs as controls

• Activity-based thermal stability assessment:

  • Enzyme activity measurements after incubation at various temperatures (25-95°C)

  • Time-course stability at selected temperatures (e.g., 60°C, 70°C, 80°C)

  • Recovery assessment after thermal stress

  • Arrhenius plot analysis to determine activation energy

• Intrinsic fluorescence spectroscopy protocol:

  • Monitoring tryptophan/tyrosine fluorescence during thermal denaturation

  • Excitation at 280 nm, emission scan 300-400 nm

  • Temperature ramping with continuous monitoring

  • Analysis of spectral shifts indicating conformational changes

• Limited proteolysis thermal stability protocol:

  • Controlled proteolytic digestion at increasing temperatures

  • SDS-PAGE analysis of fragment patterns

  • Mass spectrometry identification of thermally sensitive regions

  • Comparison with computational predictions of flexible regions

These methods should be conducted with consideration of S. azorense's optimal growth temperature (68°C) and range (50-73°C) . The thermal activation observed in other S. azorense enzymes at 60°C suggests nuoK may exhibit similar thermal behavior, potentially showing increased structural stability or even enhanced activity at elevated temperatures compared to ambient conditions.

What are the critical factors in designing chimeric proteins incorporating domains from S. azorense nuoK?

Designing chimeric proteins incorporating domains from S. azorense NADH-quinone oxidoreductase subunit K requires careful consideration of several critical factors to maintain structural integrity and functional properties:

• Domain boundary selection:

  • Detailed bioinformatic analysis to identify discrete structural domains

  • Secondary structure prediction to avoid disrupting α-helices or β-sheets

  • Multiple sequence alignment with homologs to identify conserved domains

  • Consideration of transmembrane topology to preserve membrane integration

• Linker design strategies:

  • Use of flexible linkers (Gly-Ser repeats) for independent domain movement

  • Rigid linkers (Pro-rich sequences) when domain orientation is critical

  • Optimization of linker length through molecular modeling

  • Testing multiple linker variants empirically

• Expression system considerations:

  • Selection of expression systems capable of handling membrane proteins

  • Temperature-controlled expression protocols (potentially at elevated temperatures)

  • Use of specialized E. coli strains for membrane protein expression

  • Consideration of lipid environment for proper folding

• Thermostability preservation approach:

  • Identification of key thermostabilizing features from S. azorense nuoK

  • Incorporation of critical salt bridges and hydrophobic interactions

  • Computational modeling to predict stability of chimeric constructs

  • Experimental validation through thermal denaturation studies

• Functional domain preservation:

  • Identification of catalytic residues and functional motifs

  • Maintenance of native-like environment for functionally critical regions

  • Validation of electron transfer capability in reconstituted systems

  • Comparative analysis with parent proteins

Successful fusion protein design has been demonstrated with other S. azorense proteins, such as the carbonic anhydrase (Saz_CA) which was successfully fused with a chitin binding domain from Bacillus circulans without losing thermostability or activity . This suggests that nuoK domains could similarly be incorporated into chimeric proteins while maintaining their thermophilic properties, provided appropriate design considerations are implemented.

What emerging research technologies might advance our understanding of S. azorense nuoK structure and function?

Several cutting-edge technologies hold promise for advancing our understanding of S. azorense NADH-quinone oxidoreductase subunit K structure and function:

• Advanced structural biology techniques:

  • Cryo-electron microscopy with improved resolution for membrane protein complexes

  • Microcrystal electron diffraction (MicroED) for small crystals of membrane proteins

  • Solid-state NMR methodologies optimized for membrane proteins

  • Time-resolved serial crystallography to capture functional states

• Single-molecule biophysics approaches:

  • High-temperature single-molecule FRET to observe conformational changes

  • Nanodiscs combined with atomic force microscopy for structural analysis

  • Optical tweezers experiments to measure force generation in reconstituted systems

  • Single-particle tracking in model membrane systems

• Advanced computational methods:

  • Molecular dynamics simulations at elevated temperatures mimicking thermophilic conditions

  • Machine learning approaches for predicting thermostability determinants

  • Quantum mechanics/molecular mechanics (QM/MM) for electron transfer modeling

  • Coarse-grained simulations of complex I assembly and membrane interactions

• Systems biology integration:

  • Multi-omics approaches linking protein function to cellular physiology

  • In vivo imaging of respiratory complexes in model systems

  • Metabolic flux analysis to understand energetic contributions

  • Synthetic biology approaches for minimal respiratory chain reconstruction

• Innovative biophysical techniques:

  • Neutron scattering for membrane protein hydration dynamics

  • Terahertz spectroscopy for protein-water coupling at high temperatures

  • Mass photometry for measuring stoichiometry and assembly states

  • Thermophoresis for analyzing thermal adaptation of molecular interactions

These technologies could provide breakthrough insights into how S. azorense nuoK contributes to the organism's ability to thrive in high-temperature environments (50-73°C) , similar to studies that revealed thermal activation of other S. azorense enzymes like carbonic anhydrase at 60°C .

How might genetic manipulation of S. azorense nuoK be utilized to engineer proteins with enhanced thermostability for biotechnological applications?

Genetic manipulation of S. azorense NADH-quinone oxidoreductase subunit K offers promising strategies for engineering proteins with enhanced thermostability for various biotechnological applications:

• Rational design approaches:

  • Introduction of additional salt bridges based on structural analysis

  • Enhancement of hydrophobic core packing through targeted mutations

  • Rigidification of flexible loops through proline substitutions

  • Removal of thermolabile residues (Asn, Gln) in non-critical positions

• Directed evolution strategies:

  • Error-prone PCR libraries with high-temperature selection

  • DNA shuffling with other thermophilic homologs

  • Compartmentalized self-replication at elevated temperatures

  • PACE (phage-assisted continuous evolution) with thermostability selection

• Domain swapping methodologies:

  • Identification of highly thermostable domains for creation of chimeric proteins

  • Systematic replacement of regions with counterparts from hyperthermophiles

  • Creation of libraries with randomized domain combinations

  • High-throughput screening for function at extreme temperatures

• Computational design methods:

  • In silico prediction of stabilizing mutations

  • Machine learning approaches trained on thermophilic protein datasets

  • Molecular dynamics simulations to identify dynamic instabilities

  • Rosetta-based redesign of unstable regions

• Applications of engineered variants:

  Application Area	Desired Properties	Engineering Approach
  Biofuel cells	Long-term stability at variable temperatures	Enhance core packing, surface electrostatics
  Biosensors	Function in extreme environments	Focus on active site stability, substrate binding
  Industrial biocatalysis	Tolerance to organic solvents and heat	Increase surface rigidity, introduce disulfide bonds
  Synthetic electron transport chains	Defined electron transfer properties	Optimize redox center positioning and coupling

The success of fusion protein engineering with S. azorense enzymes has already been demonstrated with carbonic anhydrase (Saz_CA), which maintained thermostability when fused with a chitin binding domain, exhibiting thermal activation at 60°C and allowing partial purification through heat treatment . Similar approaches with nuoK could yield robust electron transport components for biotechnological applications requiring high-temperature stability.

What are the most promising research avenues for S. azorense nuoK in the next decade?

The most promising research avenues for Sulfurihydrogenibium azorense NADH-quinone oxidoreductase subunit K in the coming decade span fundamental science to applied biotechnology:

• Structural biology breakthroughs:

  • High-resolution structure determination of the complete S. azorense respiratory complex I

  • Elucidation of thermostability mechanisms through comparative structural analysis

  • Investigation of conformational dynamics at different temperatures

  • Mapping protein-lipid interactions critical for membrane protein stability

• Bioenergetic mechanisms:

  • Detailed investigation of proton pumping efficiency at high temperatures

  • Understanding electron transfer pathways in thermophilic respiratory complexes

  • Quantification of energy conservation efficiency compared to mesophilic systems

  • Integration of function within the complete electron transport chain

• Biotechnological applications:

  • Development of thermostable biofuel cells incorporating nuoK elements

  • Creation of robust biosensors functioning in extreme environments

  • Engineering of minimal electron transport systems for synthetic biology

  • Design of biomimetic catalysts inspired by thermophilic electron transport

• Evolutionary insights:

  • Comparative genomics of respiratory complexes across temperature gradients

  • Molecular clock analysis of adaptation to thermal environments

  • Ancestral sequence reconstruction to trace emergence of thermostability

  • Horizontal gene transfer analysis in thermophilic adaptation

• Methodological innovations:

  • Advanced membrane protein expression and purification techniques

  • In situ structural and functional characterization methods

  • Computational tools specifically designed for thermophilic membrane proteins

  • Novel assay development for high-temperature enzyme kinetics

These research directions build upon established knowledge of S. azorense as a thermophilic organism growing optimally at 68°C within a range of 50-73°C , and the observed thermostability of its proteins, exemplified by the carbonic anhydrase which exhibits thermal activation at 60°C .

What methodological challenges remain in studying recombinant S. azorense nuoK and how might they be addressed?

Despite advances in protein biochemistry, significant methodological challenges persist in studying recombinant Sulfurihydrogenibium azorense NADH-quinone oxidoreductase subunit K, requiring innovative solutions:

• Expression and purification challenges:

  • Challenge: Achieving sufficient expression of functional membrane protein

  • Solution: Development of specialized expression systems optimized for thermophilic membrane proteins, including tunable promoters, thermostable chaperones, and lipid supplementation

• Structural determination limitations:

  • Challenge: Obtaining high-resolution structures of thermophilic membrane proteins

  • Solution: Implementation of advanced crystallization techniques for membrane proteins, incorporation into lipid nanodiscs for cryo-EM, and development of new membrane mimetics

• Functional reconstitution difficulties:

  • Challenge: Creating physiologically relevant reconstituted systems that mimic the thermophilic environment

  • Solution: Design of specialized liposomes with thermostable lipids, temperature-controlled activity assays, and development of intact membrane preparations

• Protein-protein interaction analysis:

  • Challenge: Capturing transient interactions within respiratory complexes at elevated temperatures

  • Solution: Temperature-resistant cross-linking methods, thermostable fluorescent tags for FRET studies, and specialized surface plasmon resonance instruments with temperature control

• Comparative analysis constraints:

  • Challenge: Direct comparison with mesophilic homologs across temperature ranges

  • Solution: Development of standardized assay conditions allowing normalization for temperature effects, creation of chimeric proteins with domain swaps, and computational modeling to isolate temperature-specific effects