Recombinant Sulfurihydrogenibium sp. NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Overview

NADH-quinone oxidoreductase subunit K (nuoK) is a conserved component of the NDH-1 complex, which comprises 14 subunits in bacteria . In Sulfurihydrogenibium sp., nuoK contributes to the membrane-spanning region of the enzyme, facilitating proton pumping during electron transfer . The recombinant form retains functional properties, enabling studies on its role in energy transduction.

Key Functional Attributes:

  • Catalytic Role: Participates in electron transfer from NADH to ubiquinone (EC 1.6.99.5) .

  • Structural Role: Stabilizes the membrane-embedded region of NDH-1, critical for maintaining proton gradient integrity .

Recombinant Expression and Purification

The recombinant nuoK subunit from Sulfurihydrogenibium sp. is produced in Escherichia coli with an N-terminal His tag for affinity purification .

Physicochemical Properties:

PropertyValue
Molecular Weight~11.5 kDa (calculated)
Isoelectric PointPredicted pH 8.0–9.0
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose or 50% glycerol

Comparative Analysis with Homologs

The nuoK subunit shares structural and functional homology across bacterial species:

SpeciesUniProt IDKey Features
Sulfurihydrogenibium sp.B2V983100-amino-acid full-length protein; expressed in E. coli
Helicobacter pyloriQ1CRZ1100-amino-acid sequence; 40% identity to Sulfurihydrogenibium sp.
Escherichia coliA1ADC7Partial recombinant form (yeast-expressed)

Research Applications

  • Mechanistic Studies: Used to investigate electron transfer mechanisms and inhibitor binding (e.g., rotenone, piericidin A) .

  • Structural Biology: Supports crystallization trials for NDH-1 complex mapping .

  • Biotechnological Tools: Serves as an antigen for ELISA development .

Handling and Stability

  • Reconstitution: Solubilize in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .

  • Stability: Degrades after repeated freeze-thaw cycles; working aliquots stable at 4°C for ≤1 week .

Functional Insights from Related Studies

  • The homologous NQO3 subunit in Paracoccus denitrificans binds [2Fe-2S] and [4Fe-4S] clusters, with redox potentials of -472 mV and -391 mV, respectively .

  • Inhibitors like pyridaben target the PSST/NQO6 subunit interface, suggesting nuoK’s proximity to quinone-binding sites .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
nuoK; SYO3AOP1_0878; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Sulfurihydrogenibium sp. (strain YO3AOP1)
Target Names
nuoK
Target Protein Sequence
MVPFEYYVALSGLLMVLGFIGVIIRKNIIAMLLSTELMLNAVNIAFVAFDMKLHDVVGQV FVFFILTIAAAEAAIGLGLIIAIYRMKKDVDVEKLTELKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this particular species, ubiquinone is believed to be the immediate electron acceptor for the enzyme. The enzyme couples the redox reaction with proton translocation, transporting four hydrogen ions across the cytoplasmic membrane for every two electrons transferred. This process effectively conserves the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase and what role does the nuoK subunit play?

In bacterial respiratory systems, NADH-quinone oxidoreductases may exist in several forms: the energy-transducing Complex I (NDH-1), the Na+-translocating NADH:quinone oxidoreductase (Na+-NQR), and NDH-2 which is not involved in energy transduction . The nuoK subunit specifically contributes to the proton-pumping pathway in NDH-1 type enzymes, working in concert with other membrane subunits to facilitate energy conservation.

How is recombinant Sulfurihydrogenibium sp. nuoK typically expressed and purified?

Recombinant Sulfurihydrogenibium sp. nuoK protein is typically expressed using bacterial expression systems optimized for membrane proteins. The full-length protein (amino acids 1-100) is commonly produced with a histidine tag to facilitate purification . The expression process requires careful optimization of induction conditions due to the hydrophobic nature of this membrane protein.

For purification, metal chelate chromatography is the method of choice, taking advantage of the histidine tag. Based on established protocols for similar NADH-quinone oxidoreductase subunits, the procedure typically involves:

  • Cell lysis under non-denaturing conditions

  • Membrane fraction isolation by ultracentrifugation

  • Detergent solubilization of membrane proteins

  • Nickel-affinity chromatography

  • Size exclusion chromatography for final purification

When working with the entire complex, additional steps are necessary to maintain the integrity of the multi-subunit assembly, similar to methods used for Na+-NQR purification in other bacterial systems .

What are the common methods for assessing nuoK incorporation into the NADH-quinone oxidoreductase complex?

Assessment of nuoK incorporation into the complete NADH-quinone oxidoreductase complex requires multiple analytical approaches:

  • SDS-PAGE and Western blotting: Using antibodies specific to the histidine tag or to nuoK itself can confirm the presence of the subunit in the isolated complex. As demonstrated in related complex isolations, complete incorporation of all subunits can be visualized using appropriate gel electrophoresis methods .

  • Activity assays: Measuring NADH oxidation rates and quinone reductase activity provides functional evidence of proper complex assembly. For example, Na+-stimulated dNADH oxidation can be measured spectrophotometrically at 340 nm, using extinction coefficient (ε340) of 6.22 mM−1 cm−1 for NADH and dNADH quantitation .

  • Mass spectrometry: MALDI-MS analysis can confirm the presence of nuoK in the purified complex while providing accurate mass determination to verify the integrity of the subunit.

  • Blue native PAGE: This technique allows visualization of the intact complex and can be followed by second-dimension SDS-PAGE to confirm subunit composition.

The absence of key subunits in incomplete complexes can be detected by these methods, as observed in studies of Na+-NQR assembly where missing subunits resulted in non-functional complexes .

How can experimental design address the challenges of studying membrane-bound subunits like nuoK?

Studying membrane-bound subunits like nuoK presents unique challenges that require carefully designed experimental approaches:

Solomon 4-Group Design Application: For functional studies of nuoK, adapting the Solomon 4-Group experimental design can help distinguish the effects of experimental manipulations from artifacts. This design includes four groups: two experimental and two control, with pretesting in only one experimental and one control group . When applying site-directed mutagenesis to nuoK, this approach helps isolate the effects of specific mutations by controlling for potential artifacts from expression systems or purification methods.

The experimental procedure should include:

  • Group 1: Wild-type nuoK with pretesting and post-testing

  • Group 2: Mutant nuoK with pretesting and post-testing

  • Group 3: Wild-type nuoK with only post-testing

  • Group 4: Mutant nuoK with only post-testing

This design is particularly valuable when investigating subtle functional changes in nuoK that might be masked by experimental variables.

For structural studies, complementary approaches should be employed:

  • Detergent screening to identify optimal solubilization conditions

  • Lipid reconstitution to study nuoK in a native-like environment

  • Cross-linking studies to identify interaction partners within the complex

  • Controlled proteolysis combined with mass spectrometry to map accessible regions

What approaches can resolve contradictions in nuoK activity data between different experimental systems?

Resolving contradictory activity data for nuoK requires systematic investigation of experimental variables:

  • Expression system comparison: Parallel expression in multiple bacterial hosts can identify host-specific effects. For example, expression of Na+-NQR components in E. coli (which lacks its own Na+-NQR) versus native hosts reveals that additional maturation factors may be required for complete functionality .

  • Activity assay standardization: Using multiple activity measurements provides a more comprehensive assessment than single assays. The table below illustrates how different activity measurements can reveal distinct aspects of complex function:

Activity MeasurementWhat it RevealsPotential Contradictions
Na+-stimulated dNADH oxidaseComplete functional assemblyMay be absent despite presence of all subunits if assembly is incorrect
dNADH:menadione oxidoreductaseBasic enzymatic capabilityCan be present even in incomplete complexes
NADH oxidaseBackground activity from other enzymesMay mask subtle effects of nuoK mutations
  • Complementation studies: In cases where nuoK mutations abolish activity, complementation with wild-type nuoK can confirm the specific role of the subunit. This approach has been effective in demonstrating the essential nature of maturation factors for related complexes .

  • Detailed kinetic analysis: When contradictions exist between steady-state activity measurements, transient kinetics can reveal mechanistic differences that explain the discrepancies.

How can site-directed mutagenesis be optimized to study critical residues in nuoK?

Site-directed mutagenesis of nuoK requires careful planning and execution:

  • Target residue selection: Highly conserved residues should be prioritized, particularly those in transmembrane domains that may participate in proton/ion translocation. Analysis of related NQR complexes suggests that conserved cysteine residues can be critical for proper function, as seen with the Cys33 residue in the related NqrM protein .

  • Mutation strategy:

    • Conservative substitutions (e.g., Cys to Ser) to preserve structural integrity

    • Charge-altering mutations to probe electrostatic interactions

    • Sequential alanine scanning of transmembrane segments

  • Functional validation: A hierarchical approach to functional assessment:

    • Expression level verification

    • Membrane integration confirmation

    • Complex assembly analysis

    • Activity measurements under varying conditions

  • Control mutations: Include multiple control mutations to differentiate between critical and non-critical residues. In related systems, mutation of one critical cysteine (Cys33) completely prevented complex maturation, while mutations in other conserved cysteines only decreased yield .

  • Complementary structural methods: Combine mutagenesis with structural analysis techniques such as cysteine accessibility measurements or distance constraint determinations through cross-linking.

What are the optimal conditions for measuring nuoK-containing complex activity?

Based on established protocols for similar NADH-quinone oxidoreductases, the following conditions provide optimal activity measurements:

Reaction medium composition:

  • 20 mM HEPES-Tris buffer

  • 5 mM MgSO4

  • 50 mM KCl

  • pH 8.0

For specific activity assessments:

  • NADH or dNADH concentration: 50-200 μM

  • Quinone substrate (menadione): 50 μM

  • Temperature: 30°C

  • For Na+-dependent activities: Compare activity with and without added 100 mM NaCl

Activity calculation: Use an extinction coefficient (ε340) of 6.22 mM−1 cm−1 for NADH and dNADH quantitation .

Multiple activity measurements should be performed to comprehensively assess complex function:

  • NADH/dNADH oxidase activity (complete electron transport)

  • Quinone reductase activity (terminal electron transfer)

  • NADH dehydrogenase activity (initial electron acceptance)

A reference dataset for properly functioning complexes is provided in the table below, adapted from activity measurements of related systems:

Activity TypeExpected Range (nmol·min⁻¹·mg⁻¹)
Na+-stimulated dNADH oxidase50-70
dNADH:menadione oxidoreductase250-350
NADH oxidase750-900

These values provide benchmarks against which nuoK-containing complexes can be evaluated. Significant deviations may indicate issues with complex assembly or function .

How can heterologous expression systems be optimized for functional nuoK studies?

Optimizing heterologous expression of nuoK requires addressing several critical factors:

  • Expression host selection:

    • E. coli C41/C43 strains (derived from BL21) are preferred for membrane proteins

    • Consider using hosts that naturally possess NADH-quinone oxidoreductase machinery

  • Expression construct design:

    • Include the entire operon when studying nuoK function within the complex

    • For individual subunit studies, optimize codon usage for the host

    • Include purification tags that minimally impact function

  • Co-expression of auxiliary factors:

    • Essential maturation factors may be required for functional complex assembly

    • Studies of related systems show that co-expression of maturation factors like ApbE and NqrM is necessary for producing functional complexes

  • Induction conditions:

    • Low temperature induction (16-20°C) often improves membrane protein folding

    • Extended expression times (overnight) at reduced inducer concentrations

    • Consider auto-induction media for membrane proteins

  • Functional validation strategy:

    • Implement complementation assays in knockout strains

    • Compare activity with native host preparations

    • Verify assembly state by analyzing subunit composition

Expression of Vibrio harveyi Na+-NQR genes in E. coli demonstrated that auxiliary factors were essential for producing functional enzyme. The table below shows how different combinations affected activity:

Expressed GenesNa+-stimulated dNADH oxidase activity
Core nqr genes onlyMinimal (<1 nmol·min⁻¹·mg⁻¹)
nqr genes + apbEMinimal (3 ± 1 nmol·min⁻¹·mg⁻¹)
nqr genes + apbE + nqrMSubstantial (65 ± 8 nmol·min⁻¹·mg⁻¹)

This illustrates the importance of including all necessary factors when expressing complex membrane protein assemblies .

What analytical techniques best characterize the structural integration of nuoK into the NADH-quinone oxidoreductase complex?

Comprehensive structural characterization of nuoK integration requires multiple complementary techniques:

When studying the related Na+-NQR complex, researchers observed that incomplete complexes isolated from mutant strains lacked several subunits, indicating assembly defects. This was detected using SDS-PAGE followed by mass spectrometry analysis, which showed the absence of specific subunits including NqrB, NqrD, and possibly NqrA and NqrE .

How can comparative studies between Sulfurihydrogenibium sp. nuoK and homologous subunits inform evolutionary understanding?

Comparative analysis of nuoK across species provides valuable evolutionary insights:

  • Sequence conservation analysis:

    • Identify universally conserved residues that likely play critical functional roles

    • Recognize species-specific adaptations that may reflect environmental niches

    • Map conservation patterns onto structural models to identify functional domains

  • Thermostability comparison:

    • Sulfurihydrogenibium species are thermophilic, inhabiting hot springs

    • Comparative analysis with mesophilic homologs can reveal adaptations for thermal stability

    • Structural features that differ between thermophilic and mesophilic nuoK variants may inform protein engineering

  • Functional adaptation study:

    • Compare Na+ versus H+ translocation specificity across species

    • Examine quinone binding site variations that reflect different electron acceptor preferences

    • Investigate how nuoK integrates into different types of respiratory complexes across bacterial species

  • Experimental approach:

    • Construct chimeric proteins swapping domains between species

    • Perform site-directed mutagenesis to introduce species-specific residues

    • Use complementation studies to test functional conservation

Similar comparative approaches with the maturation factor NqrM revealed that it contains conserved cysteine residues critical for Na+-NQR assembly, with the Cys33 residue being absolutely essential . This type of analysis can identify equally important residues in nuoK.

What experimental designs best test the hypothesis that nuoK plays a role in ion translocation?

Testing nuoK's role in ion translocation requires sophisticated experimental designs:

  • Site-directed mutagenesis combined with functional assays:

    • Target conserved charged or polar residues within transmembrane helices

    • Measure ion translocation rates with wild-type and mutant complexes

    • Correlate changes in ion translocation with electron transfer activities

  • Reconstitution in proteoliposomes:

    • Controlled lipid composition to minimize leakage

    • Ion-selective fluorescent dyes to monitor translocation in real-time

    • Comparative studies with different ion gradients (Na+, H+, K+)

  • Experimental design structure:

    • Implement a modified experimental design as described previously :

      • Control group: Wild-type nuoK in proteoliposomes

      • Experimental group 1: Single-site nuoK mutants

      • Experimental group 2: Double-site nuoK mutants

      • Negative control: Complex lacking nuoK entirely

  • Data collection and analysis:

    • Measure both initial rates and steady-state ion gradients

    • Determine stoichiometry between electron transfer and ion translocation

    • Compare results across different pH values and ion concentrations

  • Control experiments:

    • Ionophore addition to collapse gradients and verify measurement sensitivity

    • Inhibitor studies to block specific steps in the electron transfer pathway

    • Parallel measurements with related complexes of known ion specificity

Similar approaches to study the related Na+-NQR complex revealed that certain subunits are essential for coupling electron transfer to ion translocation, while others primarily participate in electron transfer steps .

What are common challenges in nuoK research and how can they be addressed?

Researchers working with nuoK frequently encounter several challenges:

  • Low expression levels:

    • Solution: Optimize codon usage for expression host

    • Solution: Test multiple promoter systems (T7, tac, arabinose-inducible)

    • Solution: Reduce growth temperature during induction phase (16-20°C)

  • Improper membrane integration:

    • Solution: Add fusion partners known to aid membrane insertion

    • Solution: Co-express chaperones specific for membrane proteins

    • Solution: Use detergent screening to identify optimal solubilization conditions

  • Incomplete complex assembly:

    • Solution: Co-express all complex subunits from a single plasmid

    • Solution: Include known maturation factors required for complex assembly

    • Solution: Verify the presence of all subunits using techniques like MALDI-MS

  • Loss of activity during purification:

    • Solution: Include stabilizing agents (glycerol, specific lipids)

    • Solution: Minimize exposure to oxygen if the complex is oxygen-sensitive

    • Solution: Optimize detergent type and concentration for purification

  • Inconsistent activity measurements:

    • Solution: Standardize assay conditions (buffer, pH, temperature)

    • Solution: Use multiple activity assays to comprehensively assess function

    • Solution: Include appropriate controls for background activity

Studies with related complexes showed that missing auxiliary factors resulted in non-functional complexes despite the presence of the core subunits. For example, Na+-NQR required both ApbE and NqrM for assembly of a functional complex in heterologous hosts .

How can researchers distinguish between effects on nuoK itself versus effects on the whole complex?

Distinguishing between direct effects on nuoK and indirect effects on the entire complex requires systematic investigation:

Research on related complexes demonstrated that incomplete Na+-NQR lacking specific subunits retained NADH dehydrogenase activity (12 μmol·min⁻¹·mg⁻¹) but completely lost Na+-stimulated quinone reductase activity, showing that certain subunits are essential for coupling electron transfer to ion translocation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.