Recombinant Sulfurihydrogenibium sp. Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Biochemical Role and Mechanism

UppP belongs to the BacA/UppP phosphatase family and operates in the de novo synthesis and recycling pathways of UP. Its activity ensures the availability of UP for glycosyltransferase reactions during extracellular polysaccharide assembly . The enzyme’s active site, characterized by glutamate-rich motifs (E/Q-XXX-E) and a periplasmic orientation, facilitates substrate binding and catalysis .

Key enzymatic steps:

  • Substrate: Undecaprenyl pyrophosphate (C55_{55}-PP)

  • Product: Undecaprenyl phosphate (C55_{55}-P)

  • Reaction: C55_{55}-PP + H2_2O → C55_{55}-P + Pi_i

Recombinant Production and Purification

Recombinant uppP is heterologously expressed in Escherichia coli and other systems (e.g., yeast), followed by thermal precipitation and chromatography for purification .

ParameterDetails
Expression SystemE. coli BL21-CodonPlus (DE3)-RIPL or yeast systems
TagHis-tag or untagged (determined during production)
Purity>85% (SDS-PAGE)
Storage-20°C/-80°C in Tris-based buffer with 50% glycerol

Thermal stability enables partial purification via heating (70°C for 30 min), precipitating host proteins while retaining uppP activity .

Industrial and Research Applications

Immobilized uppP on Fe3_3O4_4 nanoparticles enhances operational stability in CO2_2 capture systems, functioning efficiently at 40–60°C .

Stability Comparison:

FormResidual Activity (70°C, 70 h)Residual Activity (25°C, 30 days)
Free Enzyme30%25%
MNP-Immobilized85%100%

This stability makes it superior to mammalian carbonic anhydrase (bCA), which loses activity rapidly under similar conditions .

Genetic and Sequence Features

The uppP gene (SYO3AOP1_1321) encodes a 252-amino acid protein with a predicted transmembrane domain structure .

Sequence Highlights:

  • Active-site residues: Glu-45, Glu-49, Ser-127, Arg-128, Ser-129 .

  • Conserved motifs: MTTLEAVILGIVEGLTEFLPISSTGHLILVSNLLGIQQ... .

Future Directions

Current research focuses on:

  • Engineering hyperthermostable variants for biotechnology.

  • Mechanistic studies of lipid carrier recycling in antibiotic-resistant pathogens .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requirements. Please indicate your preference in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; SYO3AOP1_1321; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Species
Sulfurihydrogenibium sp. (strain YO3AOP1)
Target Names
uppP
Target Protein Sequence
MTTLEAVILGIVEGLTEFLPISSTGHLILVSNLLGIQQTEQHKAFEVSIQLGSILAVVFL YFKKFLDTNLMKRILIAFIPTGILGFVLYKIIKSLFNPYIVVFMLVFGGLLLILIELYHK NKSYDINSIYEVPYQKAFLIGVFQSLAMVPGTSRSGATIVGGLLLGLDRKTAAEFSFMLA VPTMFMATFYDVYKNRSNFNLSDWENLIVGFVVAFISALFAIKWLLKFISNHSFIPFGIY RIILGILYYLWY
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase (uppP) and what is its role in bacterial cell wall synthesis?

Undecaprenyl-diphosphatase (UppP) is an integral membrane protein that catalyzes the dephosphorylation of undecaprenyl pyrophosphate (Und-PP) to undecaprenyl phosphate (Und-P). This reaction is crucial for bacterial cell wall synthesis as Und-P serves as an essential carrier lipid for peptidoglycan precursors.

The process begins with Und-PP synthesis on the inner face of the cytoplasmic membrane by undecaprenyl pyrophosphate synthase (UppS) via the methylerythritol phosphate (MEP) pathway . Und-PP is also generated on the outer face of the cytoplasmic membrane when it is released during glycan polymerization. Several integral membrane pyrophosphatases, including BacA (also known as UppP) and PAP2 family proteins, then dephosphorylate Und-PP .

Sequence alignment reveals two consensus regions specific to bacterial UppP enzymes:

  • The glutamate-rich (E/Q)XXX*E motif

  • The PGXSRSXXT motif along with a conserved histidine residue

These regions form the catalytic site of UppP and face the periplasm, indicating that its enzymatic function occurs on the outer side of the plasma membrane .

What is Sulfurihydrogenibium sp. and why is its uppP important for researchers?

Sulfurihydrogenibium sp. is a thermophilic bacterium capable of withstanding extreme temperatures. For example, Sulfurihydrogenibium yellowstonense YO3AOP1 can survive at temperatures up to 100°C , while Sulfurihydrogenibium azorense is stable at temperatures up to 95°C .

The enzymes from these thermophilic organisms, including UppP, possess remarkable thermostability properties that make them valuable for both fundamental research and biotechnological applications. This thermostability offers several research advantages:

  • Enhanced stability under various experimental conditions

  • Potential use as models for studying protein structure-function relationships

  • Applications in high-temperature industrial processes

  • Insights into mechanisms of protein adaptation to extreme environments

The recombinant production of Sulfurihydrogenibium sp. UppP allows researchers to study these properties in controlled laboratory settings, facilitating detailed biochemical and structural analyses.

How do mutations in conserved regions affect UppP activity?

Site-directed mutagenesis studies have revealed the critical functional importance of the consensus regions in UppP. The following table summarizes key mutations and their effects:

MutationRegionEffect on Enzyme ActivityFold Change
E17A(E/Q)XXX*E motifDecreased k_cat~5-fold reduction
E17A(E/Q)XXX*E motifIncreased K_m for substrate~4-5 fold increase
E21A(E/Q)XXX*E motifDecreased k_cat~5-fold reduction
E17A/E21A(E/Q)XXX*E motifComplete loss of activityN/A
H30AConserved histidineSeverely impaired activityN/A
S173APGXSRSXXT motifComplete loss of activityN/A
R174APGXSRSXXT motifComplete loss of activityN/A
T178APGXSRSXXT motifComplete loss of activityN/A

These results demonstrate that the enzyme active site is composed of these two consensus regions . The E17A and E21A mutations affect residues that interact with the pyrophosphate moiety of Und-PP through a magnesium ion, while R174 establishes a hydrogen bond with the OH group of the pyrophosphate moiety. The conserved H30 residue is spatially close to the pyrophosphate moiety and plays a crucial role in catalysis.

What is the proposed structure and mechanism of UppP?

Based on three-dimensional structural modeling and molecular dynamics simulation studies, researchers have developed a model of the UppP catalytic site that provides insights into enzyme-substrate interactions in membrane bilayers . Key features include:

  • Active site orientation: The active site faces the periplasm, indicating that UppP functions on the outer side of the plasma membrane .

  • Metal coordination: Divalent cations (Mg²⁺ or Ca²⁺) are absolutely required for enzyme activity, serving to coordinate the pyrophosphate group of the substrate .

  • Substrate binding: The model shows that:

    • Glu-17 and Glu-21 within the (E/Q)XXX*E motif interact with the pyrophosphate moiety through a magnesium ion

    • Arg-174 in the PGXSRSXXT motif forms a hydrogen bond with the OH group of the pyrophosphate

    • His-30 is positioned close to the pyrophosphate moiety and likely participates in catalysis

  • Proposed mechanism: The enzyme likely uses a nucleophilic attack on the phosphate group, facilitated by metal coordination and proper positioning of the substrate by the conserved residues.

This structural understanding has facilitated the development of potential UppP inhibitors, including tetramic and tetronic acid derivatives that show antimicrobial activity .

What are the implications of UppP inhibition for antibiotic development?

UppP represents a promising target for antibiotic development for several reasons:

  • Essential pathway: UppP is involved in the essential process of bacterial cell wall synthesis. Inhibition depletes the Und-P pool, disrupting peptidoglycan synthesis and potentially causing cell death .

  • Conservation: The enzyme is conserved across bacterial species, making it a potential broad-spectrum target .

  • Multiple homologs: In E. coli, multiple genes encode proteins with UppP activity (BacA, PgpB, YbjG, and LpxT), which are conditionally essential . This redundancy suggests that combination therapies targeting multiple UppP homologs might be effective.

  • Existing inhibitors: Several classes of UppP inhibitors have been identified:

    • Tetramic and tetronic acid 3-carboxamides

    • Dihydropyridin-2-one-3-carboxamides

    • Non-bisphosphonate inhibitors identified through computer-aided drug design

  • Novel connections: Genetic screens have uncovered connections between UppP function and other cellular processes, including cell division, DNA replication/repair, signal transduction, and glutathione metabolism . These connections could inform combination therapy approaches.

A genetic screen for synthetic interactions with ΔybjG ΔlpxT ΔbacA (multiple UppP deletions) revealed that mutations in genes like qseC cause cells to enlarge and lyse , highlighting the complex cellular consequences of disrupting UppP function.

How should researchers approach experimental design for studying UppP?

When designing experiments to study UppP, researchers should follow a systematic approach based on established experimental design principles:

  • Define the objective: Clearly articulate whether the goal is to characterize enzyme kinetics, identify inhibitors, understand structure-function relationships, or another purpose .

  • Define the process and select factors: Identify independent variables that may affect UppP activity, such as:

    • pH and buffer composition

    • Temperature (especially important for thermostable enzymes)

    • Divalent cation concentration and type

    • Detergent type and concentration

    • Substrate concentration

    • Protein concentration

  • Select response measurements: Choose appropriate assays to measure UppP activity:

    • Phosphate release assays (e.g., malachite green)

    • Enzyme-coupled assays

    • Substrate depletion assays

    • For inhibition studies, consider IC₅₀ or percentage inhibition

  • Select the experimental design: Based on the number of factors and available resources:

    • Screening designs for initial exploration

    • Full factorial designs for comprehensive analysis

    • Response surface methodology for optimization

  • Execute experiments accurately: Collect data consistently to minimize variability, using appropriate controls and replicates .

  • Analyze results: Use statistical methods such as nonlinear regression analysis to establish relationships between factors and responses .

  • Verify results: Confirm findings through repeated experiments or orthogonal approaches .

This structured approach ensures that experiments are designed efficiently and yield reliable, interpretable results.

What are the challenges in expressing and purifying recombinant UppP?

Recombinant expression and purification of UppP present several challenges due to its nature as an integral membrane protein:

  • Expression challenges:

    • Low expression levels common for membrane proteins

    • Potential toxicity to host cells

    • Protein misfolding or aggregation

    • Need for membrane integration for proper folding

  • Purification challenges:

    • Requirement for detergents to solubilize the protein

    • Potential loss of activity during solubilization

    • Multiple purification steps needed to achieve high purity

    • Protein stability concerns in detergent solutions

Based on available product information for recombinant Sulfurihydrogenibium sp. proteins, successful expression strategies include:

  • Expression in E. coli as a host organism

  • Use of affinity tags (His-tag) for purification

  • Storage in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Addition of glycerol (5-50% final concentration) for stability

  • Reconstitution in deionized sterile water to 0.1-1.0 mg/mL

  • Avoiding repeated freeze-thaw cycles; storing working aliquots at 4°C for up to one week

For thermostable proteins from Sulfurihydrogenibium sp., heat treatment during purification may offer an advantage by denaturing host proteins while leaving the target protein intact .

How can researchers design effective inhibitor screening assays for UppP?

Developing effective inhibitor screening assays for UppP requires careful consideration of the enzyme's properties:

  • Assay format selection:

    • Primary screens should be simple, reproducible, and amenable to high-throughput formats

    • Consider colorimetric assays that detect inorganic phosphate release

    • Fluorescence-based assays may offer greater sensitivity

  • Assay optimization:

    • Determine optimal enzyme concentration for linear response

    • Use substrate concentration at or below K_m for maximum sensitivity to competitive inhibitors

    • Include divalent cations (Mg²⁺ or Ca²⁺) which are absolutely required for enzyme activity

    • Optimize detergent conditions to maintain enzyme stability while minimizing interference

  • Control implementation:

    • Positive controls: known inhibitors when available

    • Negative controls: buffer/vehicle only

    • Background controls: reaction mixture without enzyme

    • Counterscreening assays to identify non-specific inhibitors

  • Data analysis:

    • Conduct nonlinear regression analysis on inhibition data

    • For each inhibitor, perform at least two independent experiments

    • Calculate IC₅₀ values and determine mode of inhibition

    • Establish structure-activity relationships

  • Hit validation:

    • Confirm hits in secondary, orthogonal assays

    • Evaluate specificity against related enzymes

    • Test for direct binding using biophysical methods

    • Assess antimicrobial activity of promising compounds

For Sulfurihydrogenibium sp. UppP, considering the enzyme's thermostability, assays could potentially be performed at elevated temperatures to take advantage of this property and reduce false positives from compounds that would be unstable under physiological conditions.

How should researchers interpret contradictory results in UppP activity assays?

When faced with contradictory results in UppP activity assays, researchers should:

  • Examine methodological differences:

    • Compare protein preparation methods

    • Assess differences in assay conditions (pH, temperature, buffer composition)

    • Evaluate substrate quality and specificity

    • Consider detergent effects on enzyme conformation and activity

  • Apply rigorous statistical analysis:

    • Use appropriate statistical tests to determine significance of differences

    • Consider power analysis to ensure adequate sample size

    • Apply nonlinear regression analysis for enzyme kinetics data

    • Evaluate whether outliers reflect real biological variability or experimental error

  • Control validation:

    • Verify that all necessary controls gave expected results

    • Check for potential interfering factors in the assay system

    • Consider running parallel assays with well-characterized enzymes

  • Consider biological explanations:

    • Protein heterogeneity (different conformations or oligomeric states)

    • Post-translational modifications affecting activity

    • Presence of endogenous inhibitors or activators

    • Different isoforms or homologs with varying activity

  • Cross-validation strategies:

    • Use multiple, complementary assay methods

    • Correlate in vitro enzymatic data with in vivo phenotypic outcomes

    • Apply orthogonal approaches like structural or genetic studies

By systematically evaluating these factors, researchers can often identify the source of contradictions and develop more reliable assay protocols.

What methods are available for quantifying Und-P levels in bacterial systems?

Accurate quantification of Und-P in bacterial cells presents technical challenges due to its membrane localization and relatively low abundance. Several methodologies have been developed:

  • Radiolabeling approaches:

    • Incorporate ³²P into cellular phospholipids including Und-P

    • Extract and separate lipids by thin-layer chromatography

    • Quantify by autoradiography or scintillation counting

    • Advantages: High sensitivity and specificity

  • LC-MS/MS methods:

    • Extract membrane lipids using appropriate solvent systems

    • Separate components by liquid chromatography

    • Identify and quantify Und-P using mass spectrometry

    • Advantages: No radioactivity required; excellent specificity

  • Genetic manipulation approach:

    • Engineer strains with altered Und-P levels

    • Overexpress UppS to increase Und-P synthesis

    • Delete non-essential PGT/GTs to reduce Und-P consumption

    • Quantify effects on Und-P pool sizes

Research has demonstrated that E. coli can be engineered to maintain significantly higher levels of Und-P:

  • Wild-type E. coli: approximately 123,000 molecules of Und-P per cell

  • ΔPGT/GT cells: approximately 300,000 molecules of Und-P per cell

  • ΔPGT/GT/puppS cells: approximately 387,000 molecules of Und-P per cell (215% increase over wild-type)

These findings indicate that UppS activity limits Und-P availability and that increasing flux through Und-P pathways is an effective strategy to increase cellular Und-P levels .

How does the thermostability of Sulfurihydrogenibium sp. proteins influence experimental approaches?

The exceptional thermostability of proteins from Sulfurihydrogenibium sp. offers unique advantages and considerations for experimental design:

  • Assay temperature optimization:

    • Activity measurements should be conducted across a broad temperature range (25-95°C)

    • Thermostable enzymes like those from Sulfurihydrogenibium sp. may show optimal activity at temperatures that would denature typical proteins

    • The alpha-carbonic anhydrase from Sulfurihydrogenibium yellowstonense YO3AOP1, for example, remains active at temperatures up to 100°C

  • Purification advantages:

    • Heat treatment can be used as a purification step

    • Incubation at elevated temperatures (e.g., 70-80°C) will denature most host proteins while leaving thermostable target proteins intact

    • This approach can significantly simplify downstream purification processes

  • Storage considerations:

    • Thermostable proteins may have different optimal storage conditions

    • Room temperature storage may be feasible for short periods

    • For Sulfurihydrogenibium sp. recombinant proteins, recommended storage includes:

      • Storage at -20°C/-80°C with 6% Trehalose in buffer

      • Addition of 5-50% glycerol for long-term storage

      • Avoiding repeated freeze-thaw cycles

  • Structural studies:

    • Thermostable proteins often provide advantages for structural determination

    • Reduced conformational flexibility can facilitate crystallization

    • Comparative analysis with mesophilic homologs can reveal structural features contributing to thermostability

By leveraging these unique properties, researchers can design more robust experiments and potentially discover novel applications for thermostable enzymes like UppP from Sulfurihydrogenibium sp.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.