Recombinant Sulfurimonas denitrificans ATP synthase subunit a (atpB)

What is the basic structure and function of Sulfurimonas denitrificans ATP synthase subunit a (atpB)?

Sulfurimonas denitrificans ATP synthase subunit a (atpB) is a critical component of the F₀ sector of the F₁F₀-ATP synthase complex. The protein consists of 224 amino acids with a molecular structure that includes multiple transmembrane regions that form channels essential for proton translocation. According to structural data, atpB (Q30QW4) forms part of the membrane-embedded portion of the ATP synthase complex, with the amino acid sequence: MGELFTFFGLISHDKTFIYMTHMLLAAGIALMLVKMAMSNLKVVPTGTQNVMEAYISGVLKMGTDVMGQEAARRYLPLVATIGLFVGIANLIGVVPGFEAPTAFLEFAFTLALSVFIYYN YEGIRRQGVVKYFKHFLGPVWWLYWLMFPIEIVSHFSRLVSLSFRLFGNVKGDDMFLMVILMLAPWVLPMIPYALLTFMAFLQAFIFMMLTYVYLGSAIAVEEH .

Functionally, atpB creates the pathway for proton movement across the membrane, which is coupled to ATP synthesis in the F₁ sector. The protein is particularly important for energy conservation in S. denitrificans, which is a chemolithoautotroph capable of growth in various sulfidic environments . When studying atpB, researchers should consider its role within the complete ATP synthase complex rather than in isolation, as its function depends on interactions with other subunits.

How does the regulation of ATP synthase in Sulfurimonas denitrificans differ from other bacteria?

The regulation of ATP synthase in S. denitrificans shows distinctive characteristics compared to other bacterial species. While most ATP synthases can function bidirectionally (synthesis and hydrolysis), S. denitrificans ATP synthase exhibits a strong directional preference toward ATP synthesis with significantly inhibited hydrolysis activity . This unidirectional operation is achieved through multiple regulatory mechanisms:

• The unique ζ subunit, which bears similarity to the mammalian IF₁ inhibitor protein

• The ε subunit's C-terminal domain (ε-CTD)

• Mg-ADP inhibition

Research has demonstrated that contrary to earlier assumptions, the ζ subunit contributes only moderately to hydrolysis inhibition, increasing rates merely two-fold (to 0.026 μmol min⁻¹ mg⁻¹) when deleted . Similarly, deletion of the ε-CTD did not substantially activate hydrolysis, with all mutant strains showing hydrolysis rates ≤0.074 μmol min⁻¹ mg⁻¹, significantly lower than rates observed in E. coli (0.38 μmol min⁻¹ mg⁻¹) and B. taurus (1.24 μmol min⁻¹ mg⁻¹) under similar conditions . This suggests that Mg-ADP inhibition may be the predominant regulatory mechanism in S. denitrificans ATP synthase.

Methodologically, researchers investigating these regulatory differences should employ ATP hydrolysis assays with various activators such as oxyanions, the detergent lauryldimethylamine oxide (LDAO), or apply a proton motive force, all of which help release Mg-ADP inhibition .

What are the key differences between recombinant and native Sulfurimonas denitrificans atpB for research applications?

When working with recombinant versus native S. denitrificans atpB, researchers should be aware of several critical differences that impact experimental design and interpretation:

For functional studies, recombinant atpB often requires reconstitution into liposomes or nanodiscs to restore membrane-associated functions. The presence of the TAT motif in Type II SQRs from Sulfurimonas species suggests that proper protein folding may occur in the cytoplasm before translocation . Therefore, when expressing recombinant atpB, researchers should consider expression systems that can accommodate this folding process, particularly under conditions that mimic the native environment of S. denitrificans, which includes marine sediments and sulfidic habitats .

What are the optimal conditions for expressing recombinant Sulfurimonas denitrificans atpB in heterologous systems?

When expressing recombinant S. denitrificans atpB in heterologous systems, researchers should optimize several critical parameters to ensure proper protein folding and functionality:

• Expression Host Selection:

  • E. coli BL21(DE3) or C43(DE3) strains are preferred for membrane proteins

  • Consider Rhodococcus or Pseudomonas species for better membrane protein expression

• Vector Design:

  • Include the native signal sequence or a compatible secretion signal

  • Consider codon optimization for the host organism

  • Incorporate a cleavable affinity tag (His₆ or Strep-tag II) for purification

• Expression Conditions:

  • Temperature: Lower temperatures (16-20°C) often improve proper folding

  • Induction: Use lower IPTG concentrations (0.1-0.5 mM) for slower expression

  • Media: Supplementation with specific lipids may improve membrane integration

  • Growth phase: Induce at mid-log phase (OD₆₀₀ = 0.6-0.8)

• Membrane Fraction Isolation:

  • Use gentle lysis methods (e.g., enzymatic lysis with lysozyme)

  • Differential centrifugation to separate membrane fractions

  • Solubilization with mild detergents (DDM, LDAO, or digitonin)

S. denitrificans proteins may present special challenges due to the organism's adaptation to marine environments. Including 2-3% NaCl in growth media may improve folding. Additionally, the inclusion of the complete ATP synthase operon or at least adjacent subunits may improve the stability and folding of atpB, as interaction with partner proteins often aids in proper folding of membrane proteins.

What analytical methods are most effective for studying the structure-function relationship of recombinant Sulfurimonas denitrificans atpB?

To effectively study the structure-function relationship of recombinant S. denitrificans atpB, researchers should employ a multi-technique approach:

• Structural Analysis Methods:

  • X-ray crystallography (challenging for membrane proteins)

  • Cryo-electron microscopy (cryo-EM) for larger complexes

  • NMR spectroscopy for dynamic studies of specific domains

  • Hydrogen-deuterium exchange mass spectrometry for conformational changes

  • Circular dichroism (CD) spectroscopy for secondary structure assessment

• Functional Analysis Methods:

  • ATP hydrolysis assays (NADH-coupled ATP regenerating assay)

  • Proton translocation assays using pH-sensitive fluorescent dyes

  • Reconstitution into liposomes to measure ATP synthesis

  • Patch-clamp techniques for proton channel activity

  • Site-directed mutagenesis to identify critical residues

• Interaction Analysis Methods:

  • Cross-linking coupled with mass spectrometry

  • Surface plasmon resonance (SPR) for binding kinetics

  • Isothermal titration calorimetry (ITC) for thermodynamic parameters

  • Blue native PAGE for complex assembly analysis

  • Förster resonance energy transfer (FRET) for dynamic interactions

Given that S. denitrificans ATP synthase has unique regulatory features involving the ε and ζ subunits and Mg-ADP inhibition , studies should particularly focus on the interaction interfaces between atpB and these regulatory components. For functional studies, researchers should consider the effects of oxyanions, LDAO, and proton motive force, which are known to activate ATP hydrolysis by releasing Mg-ADP inhibition .

How can I optimize purification protocols for recombinant Sulfurimonas denitrificans atpB while maintaining its native conformation?

Optimizing purification protocols for recombinant S. denitrificans atpB requires balancing efficient isolation with preservation of native conformation:

• Initial Extraction:

  • Use mild detergents (DDM, LDAO, digitonin) at concentrations just above CMC

  • Include lipids (0.01-0.05% phosphatidylcholine) to stabilize the protein

  • Work at physiologically relevant pH (pH 7.0-7.5) and salt concentration (300-500 mM NaCl)

  • Maintain reducing conditions with 1-5 mM DTT or 2-10 mM β-mercaptoethanol

• Purification Steps:

  • Use immobilized metal affinity chromatography (IMAC) for His-tagged protein

  • Follow with size exclusion chromatography to remove aggregates

  • Consider ion exchange chromatography for further purification

  • Maintain detergent concentration above CMC throughout all steps

• Conformation Validation:

  • Circular dichroism to confirm secondary structure

  • Fluorescence spectroscopy to assess tertiary structure

  • Limited proteolysis to probe for correct folding

  • Activity assays to confirm functionality

• Storage Considerations:

  • Store in Tris-based buffer with 50% glycerol at -20°C for extended storage

  • Alternative storage: aliquot and flash-freeze in liquid nitrogen, store at -80°C

  • Avoid repeated freeze-thaw cycles

  • For short-term storage (up to one week), keep working aliquots at 4°C

S. denitrificans atpB requires careful handling as a membrane protein. After purification, reconstitution into nanodiscs or liposomes can help maintain native conformation for functional studies. Monitoring protein stability through activity assays or biophysical methods throughout purification is crucial, as membrane proteins often lose activity during detergent solubilization.

How does the atpB subunit contribute to the unusual directionality preference of ATP synthase in Sulfurimonas denitrificans?

The atpB subunit plays a crucial role in the directional preference of ATP synthase in S. denitrificans, which shows a strong bias toward ATP synthesis over hydrolysis. This directionality is a complex interplay of structural features and regulatory mechanisms:

The architecture of the proton channel formed by atpB creates an asymmetry that influences the energy landscape for proton movement. Within this channel, specific amino acid residues likely create a unidirectional valve-like structure that favors proton flow in the direction supporting ATP synthesis. Research suggests that this structural bias works in concert with regulatory elements including the ε-CTD and ζ subunit .

While deletion studies of the ε-CTD and ζ subunit have shown limited effects on activating ATP hydrolysis individually (with rates remaining ≤0.074 μmol min⁻¹ mg⁻¹), the interaction between atpB and these regulatory components likely stabilizes conformations that inhibit reverse rotation of the c-ring . The proton channel characteristics of atpB may also contribute to stronger Mg-ADP inhibition, which has been shown to be a major factor in preventing ATP hydrolysis .

To investigate this experimentally, researchers should consider:

• Site-directed mutagenesis of key residues in the proton channel of atpB

• Chimeric constructs swapping regions of atpB between species with different directional preferences

• Cross-linking studies to identify interactions between atpB and regulatory subunits

• Molecular dynamics simulations to model proton movement through the channel under different conditions

Researchers should be aware that, unlike in other bacteria, the directionality in S. denitrificans ATP synthase appears to be an intrinsic property that cannot be completely reversed even by removing known regulatory elements .

What is the evolutionary significance of the ATP synthase atpB subunit in Sulfurimonas denitrificans compared to other bacterial lineages?

The evolutionary trajectory of the ATP synthase atpB subunit in S. denitrificans reflects adaptations to its unique ecological niche and metabolic strategy:

S. denitrificans belongs to Epsilonproteobacteria, a group that diverged early in proteobacterial evolution and occupies specialized niches including sulfidic environments . Comparative genomic analyses reveal that the atpB subunit of S. denitrificans has evolved distinct features that optimize energy conservation in these habitats.

The unidirectional operation of S. denitrificans ATP synthase represents an evolutionary adaptation to environments where energy is limited and must be conserved efficiently. Unlike many bacterial ATP synthases that function reversibly, the strong directional preference toward synthesis prevents wasteful ATP hydrolysis . This adaptation is particularly valuable in the chemolithoautotrophic lifestyle of S. denitrificans, which relies on the oxidation of reduced sulfur compounds coupled to the reduction of nitrate or other electron acceptors .

Phylogenetic analysis shows that S. denitrificans has acquired genes through horizontal gene transfer, which has contributed to its metabolic versatility . This genomic plasticity likely extended to components of its energy conservation machinery, including ATP synthase. The genome of S. denitrificans DSM1251 (2.2 Mb) is larger than many other Epsilonproteobacteria, suggesting extensive gene acquisition during its evolution .

For experimental investigation of these evolutionary aspects, researchers should:

• Conduct comparative genomic analyses across Epsilonproteobacteria and other bacterial lineages

• Perform phylogenetic analyses of ATP synthase components

• Identify signatures of selection in atpB sequences

• Use ancestral sequence reconstruction to investigate the evolution of directionality

These approaches can provide insights into how the atpB subunit evolved its unique properties in S. denitrificans compared to other bacterial lineages.

How do environmental conditions affect the expression and functionality of atpB in Sulfurimonas denitrificans?

The expression and functionality of atpB in S. denitrificans are significantly influenced by environmental conditions, reflecting the organism's adaptation to various sulfidic habitats:

• Oxygen Concentration:

  • S. denitrificans is a microaerophilic organism

  • Under oxygen-limited conditions, ATP synthase expression is upregulated to maximize energy conservation from limited electron acceptors

  • Complete anoxia triggers metabolic shifts that alter ATP synthase regulation

• Electron Donor/Acceptor Availability:

  • With thiosulfate as electron donor and nitrate as acceptor, ATP synthase expression is optimized for the coupling of denitrification to energy conservation

  • Changes in electron donor types (hydrogen vs. reduced sulfur compounds) alter the proton motive force generation and consequently affect ATP synthase activity

  • Under electron acceptor limitation, ATP synthase directionality becomes even more critical to prevent ATP hydrolysis

• pH and Ionic Strength:

  • Marine environments have higher ionic strength, which affects proton gradient formation

  • S. denitrificans is adapted to marine conditions (can be found in marine sediments)

  • pH fluctuations affect the proton motive force and directly impact ATP synthase efficiency

• Temperature:

  • S. denitrificans is found in environments ranging from hydrothermal vents to cold marine sediments

  • Temperature affects membrane fluidity and protein conformation, thereby influencing atpB functionality

  • ATP synthase assembly and stability are temperature-dependent

To study these environmental effects experimentally, researchers should:

• Use transcriptomics and proteomics to profile expression changes under different conditions

• Employ membrane vesicle preparations to measure ATP synthesis/hydrolysis rates across environmental gradients

• Apply biophysical techniques to assess structural changes in the ATP synthase complex

• Develop in vitro systems that can replicate the ionic and pH conditions of natural habitats

Understanding these environmental influences is crucial for interpreting the ecological role of S. denitrificans in biogeochemical cycles, particularly in sulfur and nitrogen cycling in marine environments .

How does the function of atpB in Sulfurimonas denitrificans contribute to its adaptation to diverse ecological niches?

The atpB subunit contributes significantly to S. denitrificans' remarkable ability to colonize diverse ecological niches through several adaptive mechanisms:

• Optimized Proton Channeling:
  The atpB subunit's structure appears optimized for efficient proton translocation across varying proton gradient strengths. This adaptation allows S. denitrificans to thrive in environments with fluctuating redox conditions, from stable marine sediments to dynamic hydrothermal vent systems . The amino acid composition of the proton channel likely reflects adaptations to the specific pH ranges and ion concentrations encountered in these diverse habitats.

• Integration with Electron Transport Systems:
  The ATP synthase containing atpB works in concert with various electron transport systems in S. denitrificans. This organism possesses multiple sulfide:quinone reductases and hydrogenases acquired through horizontal gene transfer . This metabolic flexibility allows adaptation to environments with different electron donors, with ATP synthase serving as the common endpoint for energy conservation.

• Niche-Specific Regulation:
  The regulation of ATP synthase functionality through the ε-CTD, ζ subunit, and Mg-ADP inhibition mechanism represents an adaptation to environments where energy conservation is critical. In sulfidic habitats with fluctuating nutrient availability, preventing wasteful ATP hydrolysis becomes a significant selective advantage.

• Environmental Stress Response:
  The atpB subunit likely contains adaptations for functioning under environmental stresses common in S. denitrificans habitats. For example, protein folding in the periplasm may face challenges under high salt concentrations or in highly reduced and acidic environments like hydrothermal vents . The potential presence of TAT motifs suggests mechanisms for proper protein folding under challenging conditions.

These adaptations collectively contribute to S. denitrificans' success across marine environments, from coastal sediments to deep-sea hydrothermal vents. The optimization of energy conservation through ATP synthase is a key factor enabling S. denitrificans to play important roles in biogeochemical cycling, particularly in the sulfur and nitrogen cycles .

What interactions exist between ATP synthase activity and other metabolic pathways in Sulfurimonas denitrificans?

ATP synthase activity in S. denitrificans is intricately connected with multiple metabolic pathways through energy coupling and regulatory interactions:

• Sulfur Oxidation Pathways:
  S. denitrificans possesses pathways for oxidizing various reduced sulfur compounds, including thiosulfate . These oxidation processes generate electrons that enter the electron transport chain, ultimately establishing the proton gradient that drives ATP synthase. The rate of ATP synthesis is therefore directly coupled to the activity of enzymes like sulfide:quinone reductases (SQRs). Notably, S. denitrificans possesses multiple copies of SQRs, providing metabolic flexibility that ultimately feeds into ATP production .

• Denitrification Pathway:
  As a denitrifier, S. denitrificans uses nitrate as an electron acceptor . The denitrification pathway consumes protons during nitrate reduction to nitrogen gas, which affects the proton gradient available for ATP synthesis. This creates a balanced relationship where electron transport during denitrification contributes to the proton motive force while also partially diminishing it through proton consumption.

• Carbon Fixation:
  S. denitrificans is an autotroph that fixes carbon dioxide through the reverse TCA cycle , which is energetically more efficient than the Calvin cycle but still requires substantial ATP input. The ATP produced by ATP synthase directly powers this carbon fixation, creating a dependency where environmental conditions affecting ATP synthase efficiency will influence growth rates and biomass production.

• Regulatory Cross-talk:
  The activity state of ATP synthase provides feedback to other metabolic pathways through sensing mechanisms. When ATP levels are high, catabolic pathways may be downregulated, while anabolic pathways are activated. Conversely, when ATP synthesis is limited, S. denitrificans likely redirects resources toward energy-generating pathways.

This metabolic integration places ATP synthase at the center of S. denitrificans' adaptability to changing environmental conditions. The unidirectional nature of its ATP synthase represents a specialized adaptation that ensures consistent energy conversion efficiency even under fluctuating conditions, supporting its role in biogeochemical cycling in diverse marine environments .

What are the potential applications of recombinant Sulfurimonas denitrificans atpB in bioenergetic research?

Recombinant S. denitrificans atpB offers several valuable applications in bioenergetic research due to its unique characteristics and the organism's specialized energy metabolism:

• Model System for Unidirectional ATP Synthases:
  The strong synthesis directionality of S. denitrificans ATP synthase provides an excellent model for studying the molecular basis of unidirectional energy transduction. Recombinant atpB can be used in comparative studies with bidirectional ATP synthases to identify critical structural determinants of directionality, potentially leading to the development of synthetic enzymes with controlled directional bias.

• Investigation of Extreme Environment Adaptations:
  As S. denitrificans inhabits environments ranging from marine sediments to hydrothermal vents , its atpB likely contains adaptations for function under various extreme conditions. Recombinant atpB can be used to study how ATP synthases maintain functionality under high pressure, varying salinity, or fluctuating redox conditions, providing insights for designing robust bioenergetic systems.

• Proton Channel Structure-Function Studies:
  The atpB subunit forms the critical proton channel in ATP synthase. Recombinant versions with strategic mutations can elucidate the precise mechanism of proton translocation and how it couples to ATP synthesis. This knowledge extends beyond bacterial systems to fundamental understanding of all rotary ATP synthases, including mitochondrial and chloroplast variants.

• Development of Novel Inhibitors:
  The unique regulatory mechanisms of S. denitrificans ATP synthase involving the ε-CTD, ζ subunit, and Mg-ADP inhibition offer targets for developing specific inhibitors. Recombinant atpB can be used in high-throughput screening assays to identify compounds that modulate ATP synthase activity, with potential applications in developing antimicrobials against related pathogenic Epsilonproteobacteria.

• Biosensor Development:
  Engineered versions of recombinant atpB could be developed into biosensors for detecting changes in proton gradients or membrane potential, with applications in environmental monitoring or cellular bioenergetics research.

These applications highlight the value of recombinant S. denitrificans atpB as both a research tool and a template for biotechnological innovations in bioenergetics. The unusual properties of this protein provide unique opportunities to explore fundamental aspects of energy transduction in biological systems.

What are the current methodological challenges in studying Sulfurimonas denitrificans atpB, and how might they be addressed?

Researchers studying S. denitrificans atpB face several significant methodological challenges that require innovative approaches:

• Membrane Protein Expression and Purification:

  • Challenge: As a hydrophobic membrane protein, atpB is difficult to express in heterologous systems and tends to aggregate during purification.

  • Solution Approaches:

    • Use specialized expression strains designed for membrane proteins (C43(DE3))

    • Employ fusion partners that enhance solubility (MBP, SUMO)

    • Develop native-like membrane mimetics (nanodiscs, SMALPs) for stabilization

    • Optimize detergent selection through systematic screening of detergent types and concentrations

• Functional Reconstitution:

  • Challenge: Maintaining functionality of isolated atpB or reconstituted ATP synthase complexes.

  • Solution Approaches:

    • Co-express multiple subunits to promote proper complex assembly

    • Develop lipid composition mixtures that mimic the native S. denitrificans membrane

    • Use controlled proteoliposome reconstitution with defined orientation

    • Apply microfluidic systems for creating artificial membrane environments

• Studying Directional Preference:

  • Challenge: Isolating the contribution of atpB to the unidirectional nature of S. denitrificans ATP synthase.

  • Solution Approaches:

    • Create chimeric proteins with regions from bidirectional ATP synthases

    • Develop sensitive assays that can detect minimal hydrolysis activity

    • Use single-molecule techniques to monitor rotation direction

    • Apply computational modeling to predict the energy landscape of different conformational states

• Replicating Native Environmental Conditions:

  • Challenge: Recreating the specific conditions of S. denitrificans' natural habitats in laboratory settings.

  • Solution Approaches:

    • Develop specialized bioreactors that mimic redox gradients found in natural habitats

    • Implement high-pressure systems for studying effects of hydrostatic pressure

    • Use metabolomic approaches to identify natural stabilizing factors

    • Design environmental simulation chambers with precise control of multiple parameters

• Structural Analysis:

  • Challenge: Obtaining high-resolution structural data for atpB.

  • Solution Approaches:

    • Apply advances in cryo-EM for membrane protein complexes

    • Use integrative structural biology combining multiple low-resolution techniques

    • Develop improved crystallization methods for membrane proteins

    • Employ hydrogen-deuterium exchange mass spectrometry for dynamic structural information

Addressing these challenges requires interdisciplinary approaches combining expertise in protein biochemistry, biophysics, synthetic biology, and environmental microbiology. Collaborative research between labs specializing in these different areas offers the most promising path forward.