Recombinant Sulfurimonas denitrificans NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Functional Role in Respiratory Complex I

NuoK is a core subunit of NADH-quinone oxidoreductase (EC 1.6.99.5), which catalyzes electron transfer from NADH to ubiquinone, coupled with proton translocation across the membrane . In S. denitrificans, this enzyme supports chemolithoautotrophic growth by enabling energy conservation during oxidation of reduced sulfur compounds or hydrogen . Key mechanistic features include:

  • Participation in quinone-binding domains critical for electron-proton coupling .

  • Conservation across bacteria (e.g., Paracoccus denitrificans, Thermus thermophilus) with homologous PSST subunits implicated in iron-sulfur cluster N2 interactions .

Genomic and Metabolic Context

The nuoK gene (Suden_1818) is part of a 14-subunit nuo operon in the 2.2 Mbp S. denitrificans genome . This operon enables:

  • Integration with sulfur oxidation pathways (e.g., Sox system) for electron donation .

  • Metabolic flexibility to switch between nitrate and oxygen as terminal electron acceptors .

Research Applications

Recombinant nuoK serves as a model for studying:

  • Complex I Assembly: Structural insights into prokaryotic vs. eukaryotic NADH dehydrogenase evolution .

  • Inhibitor Binding: Sensitivity to rotenone, piericidin A, and pyridaben analogs highlights conserved quinone-interaction regions .

  • Biotechnological Engineering: Optimization of electron transport in synthetic microbial systems .

Comparative Analysis

Functional parallels exist between S. denitrificans nuoK and homologs in other bacteria:

OrganismGeneRoleInhibitor Sensitivity
S. denitrificansSuden_1818Quinone redox coupling in Complex IPyridaben derivatives
Paracoccus denitrificansnuoKElectron transfer to ubiquinoneRotenone, piericidin A
Thermus thermophilusNQO6Iron-sulfur cluster coordinationBullatacin

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please specify them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you may use as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
nuoK; Suden_1818; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) (Thiomicrospira denitrificans (strain ATCC 33889 / DSM 1251))
Target Names
nuoK
Target Protein Sequence
MMEIGLNHYLVLSTILFAIGLVGVMRRKNLLMLFFATEILLNSVNISFAAISHYYGDLTG QMFAFFVIAIAASEVAVGLGLLIVWHKKHNNIDLDNMSTMRG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be ubiquinone. It couples the redox reaction with proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thereby conserving redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Sulfurimonas denitrificans nuoK and what is its role in cellular energy metabolism?

Sulfurimonas denitrificans nuoK is a small membrane protein (102 amino acids) that functions as a subunit of the NADH-quinone oxidoreductase complex (NDH-1/complex I). It is the bacterial homologue of the mitochondrial ND4L subunit, which is the smallest mitochondrial DNA-encoded component of the proton-translocating NADH-quinone oxidoreductase . The protein plays a crucial role in the energy conservation mechanism of S. denitrificans, participating in the coupling of electron transfer to proton translocation across the membrane.

The nuoK subunit contains highly conserved glutamic acid residues (particularly Glu-36 and Glu-72) that are embedded within the membrane and are critical for the proton-pumping function of the complex. Mutations in these residues result in severe impairment of coupled electron transfer activities, suggesting their essential role in the bioenergetic function of the complex .

How is recombinant nuoK typically produced for research applications?

Recombinant Sulfurimonas denitrificans nuoK is typically produced using Escherichia coli as an expression host. The process involves:

  • Cloning the full-length nuoK gene (encoding amino acids 1-102) into an appropriate expression vector

  • Adding an N-terminal histidine tag to facilitate purification

  • Transforming the construct into an E. coli expression strain

  • Inducing protein expression under controlled conditions

  • Harvesting cells and extracting the membrane fraction

  • Purifying the His-tagged protein using affinity chromatography

  • Performing quality control to ensure protein integrity and purity (>90% as determined by SDS-PAGE)

What are the optimal storage and handling conditions for recombinant nuoK?

For optimal stability and activity, recombinant nuoK should be handled and stored according to the following guidelines:

  • The lyophilized protein should be briefly centrifuged prior to opening to ensure all material is at the bottom of the vial.

  • Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • For long-term storage, add glycerol to a final concentration of 5-50% (50% is recommended) and store in aliquots at -20°C/-80°C.

  • Avoid repeated freeze-thaw cycles as they can degrade the protein's structure and function.

  • Working aliquots may be stored at 4°C for up to one week.

  • The reconstituted protein is typically stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

These conditions are designed to maintain the structural integrity and functional activity of the nuoK protein, which is particularly important for membrane proteins that are prone to aggregation and denaturation.

How can researchers design site-directed mutagenesis experiments to investigate nuoK function?

When designing site-directed mutagenesis experiments for nuoK functional studies, researchers should follow these methodological approaches:

  • Target selection: Focus on highly conserved residues that are likely to be functionally important. For nuoK, the glutamic acid residues (particularly Glu-36 and Glu-72) that are embedded within the membrane and arginine residues on the cytosolic loops are prime candidates .

  • Mutation strategy: Consider the chemical properties of the amino acid replacements:

    • Conservative replacements (e.g., Glu→Asp) to test the importance of side chain length

    • Non-conservative replacements (e.g., Glu→Gln) to test the importance of charge

    • Alanine scanning to remove side chain functionality entirely

  • Homologous recombination technique: Use homologous recombination to introduce precise mutations into the nuoK gene within the NDH-1 operon .

  • Validation of assembled complex: Use blue-native gel electrophoresis and immunostaining to verify that the mutated nuoK protein is properly incorporated into the NDH-1 complex .

  • Functional assays: Measure both electron transfer activity and proton translocation to assess the impact of mutations on the coupling mechanism.

Example results table from mutagenesis studies:

MutationComplex AssemblyElectron Transfer Activity (% of WT)Proton Translocation (% of WT)Impact on Coupling
Wild-typeComplete100100N/A
Glu-36→AspComplete45-5015-20Severe disruption
Glu-36→GlnComplete10-15<5Almost complete loss
Glu-72→AspComplete60-6530-35Moderate disruption
Glu-72→GlnComplete35-4010-15Significant loss
Arg-XX/YY→AlaComplete70-7540-45Moderate impact

This methodological approach has revealed that mutations of the nearly perfectly conserved Glu-36 lead to almost null activities of coupled electron transfer with a concomitant loss of electrochemical gradient generation, while Glu-72 mutations cause significant but less severe impairment .

What techniques are most effective for studying nuoK-membrane interactions?

For studying the interactions between nuoK and the membrane environment, researchers should employ a combination of complementary techniques:

  • Membrane fractionation and protein extraction:

    • Differential centrifugation to isolate membrane fractions

    • Sequential extraction with detergents of increasing strength to determine the degree of membrane association

    • Analysis of extracted proteins by Western blotting to track nuoK distribution

  • Membrane reconstitution:

    • Purification of recombinant nuoK in detergent

    • Controlled reconstitution into liposomes of defined lipid composition

    • Assessment of orientation using protease protection assays

  • Site-specific labeling and spectroscopic techniques:

    • Introduction of cysteine residues at strategic positions

    • Labeling with environment-sensitive fluorescent probes

    • Fluorescence spectroscopy to monitor membrane interactions and conformational changes

  • Computational approaches:

    • Molecular dynamics simulations to predict nuoK-lipid interactions

    • Hydropathy analysis to identify membrane-spanning segments

    • Evolutionary analysis to identify conserved residues at the protein-lipid interface

These techniques can provide insights into how nuoK is positioned within the membrane and how this positioning affects its function in the NADH-quinone oxidoreductase complex. Studies with S. denitrificans enzymes like sulfide-quinone reductases have shown that membrane association can be relatively loose but functionally important , suggesting similar properties might apply to nuoK.

How can researchers assess the functional activity of recombinant nuoK?

Assessing the functional activity of recombinant nuoK requires specialized approaches since it functions as part of the multi-subunit NADH-quinone oxidoreductase complex. The following methodological framework is recommended:

  • Heterologous expression and complementation:

    • Express recombinant nuoK in a nuoK-deletion mutant strain

    • Measure restoration of NADH-quinone oxidoreductase activity

    • Assess growth phenotypes under conditions requiring complex I function

  • Electron transfer activity measurements:

    • NADH:ubiquinone oxidoreductase activity assays using artificial electron acceptors

    • Measurement of NADH oxidation rates spectrophotometrically

    • Inhibitor sensitivity studies to confirm specific complex I activity

  • Proton translocation assays:

    • Measurement of membrane potential generation using potential-sensitive dyes

    • pH measurements to detect proton translocation

    • Determination of H+/e- ratios to assess coupling efficiency

  • Structural integration assessment:

    • Blue native-PAGE to verify incorporation into the complex

    • Crosslinking studies to identify subunit interactions

    • Proteoliposome reconstitution to assess activity in a defined system

These approaches provide complementary information about the functional integration of nuoK into the NADH-quinone oxidoreductase complex. Similar methodologies have been successfully applied to study the function of SQR proteins in S. denitrificans, where heterologous expression in R. capsulatus was used to confirm functional activity .

How do conserved glutamic acid residues in nuoK contribute to the proton-pumping mechanism?

The conserved glutamic acid residues in nuoK, particularly Glu-36 and Glu-72, play critical roles in the proton-pumping mechanism of NADH-quinone oxidoreductase. Advanced research has revealed:

  • Structural positioning: These residues are located within the membrane domain of nuoK and are positioned to participate in proton transfer pathways. Glu-36 is nearly perfectly conserved across species, suggesting an essential functional role .

  • Mutational effects: Site-directed mutagenesis studies show that:

    • Mutations of Glu-36 lead to almost complete loss of coupled electron transfer activity and proton translocation

    • Glu-72 mutations cause significant but less severe impairment of coupling

    • Even conservative substitutions (Glu→Asp) substantially reduce proton pumping efficiency

  • Proton transfer pathway: These glutamic acid residues are proposed to form part of a proton transfer pathway through the membrane domain of the complex, potentially:

    • Acting as proton donors/acceptors in a relay mechanism

    • Undergoing protonation/deprotonation cycles coupled to conformational changes

    • Coordinating with other charged residues to form a complete proton translocation pathway

  • Energy transduction: The positioning of these residues enables them to couple the energy released during electron transfer to the mechanical work of proton pumping, likely through conformational changes that alter the pKa values and accessibility of these residues.

What is the relationship between nuoK and sulfide metabolism in Sulfurimonas denitrificans?

While nuoK functions as part of the NADH-quinone oxidoreductase complex (NDH-1), Sulfurimonas denitrificans also possesses specialized metabolic pathways for sulfide oxidation that interact with the electron transport chain. The relationship between nuoK and sulfide metabolism involves:

  • Complementary energy conservation pathways:

    • S. denitrificans is a sulfur-oxidizing epsilonproteobacterium that grows optimally with sulfide concentrations between 0.18 mM and 1.7 mM

    • The organism possesses three distinct sulfide-quinone reductase (SQR) genes (Suden_2082, Suden_1879, and Suden_619), which encode type II, type III, and type IV SQRs respectively

    • All three SQRs are transcribed and functional in S. denitrificans, allowing flexible sulfide utilization under different conditions

  • Electron transport chain integration:

    • SQRs oxidize sulfide to elemental sulfur or polysulfides while reducing quinones

    • The reduced quinones can then feed electrons into the respiratory chain, potentially including complex I (containing nuoK)

    • This creates a potential metabolic connection between sulfide oxidation and proton pumping via complex I

  • Membrane association patterns:

    • Both nuoK and the SQRs are membrane-associated proteins

    • Studies indicate that S. denitrificans SQRs are loosely bound to the membrane , which might influence their interaction with other membrane complexes including those containing nuoK

  • Metabolic flexibility:

    • S. denitrificans can grow with various reduced sulfur compounds and hydrogen as electron donors

    • This metabolic flexibility may involve differential regulation and interaction of nuoK-containing complexes and sulfide-oxidizing enzymes

Understanding this relationship provides insights into how S. denitrificans integrates different energy conservation pathways to thrive in its ecological niche. The presence of multiple functional SQRs suggests a sophisticated system for sulfide metabolism that may interact with the NADH-quinone oxidoreductase complex under different environmental conditions .

How can researchers compare the structure-function relationship of nuoK across different bacterial species?

To effectively compare the structure-function relationship of nuoK across different bacterial species, researchers should employ a multi-faceted approach:

  • Comparative sequence analysis:

    • Multiple sequence alignment of nuoK homologs to identify universally conserved residues

    • Calculation of conservation scores for each position

    • Identification of species-specific variations in otherwise conserved regions

    • Correlation of sequence divergence with ecological niche or metabolic capabilities

  • Structural modeling and analysis:

    • Homology modeling based on available structures of complex I

    • Prediction of transmembrane topology and secondary structure

    • Identification of conserved structural motifs despite sequence variation

    • Analysis of co-evolving residues that maintain structural integrity

  • Heterologous expression and functional studies:

    • Expression of nuoK homologs from different species in a model organism

    • Creation of chimeric proteins to identify functionally important domains

    • Site-directed mutagenesis targeting species-specific variations

    • Functional assays to correlate structural differences with activity

  • Phylogenetic analysis:

    • Construction of phylogenetic trees based on nuoK sequences

    • Correlation of evolutionary distance with functional divergence

    • Identification of potential horizontal gene transfer events

    • Analysis of selection pressure on different regions of the protein

Example data table for comparative analysis:

SpeciesKey Conserved ResiduesSpecies-Specific VariationsMembrane AssociationFunctional Properties
S. denitrificansGlu-36, Glu-72, Arg-XX/YY102 aa length, His-XX positionIntegral membrane proteinCritical for proton pumping
E. coliGlu-36, Glu-72, Arg-XX/YY100 aa length, Leu-XX positionIntegral membrane proteinEssential for coupling
P. denitrificansGlu-36, Glu-72, Arg-XX/YY98 aa length, Val-XX positionIntegral membrane proteinRequired for NADH oxidation
T. thermophilusGlu-36, Glu-72, Arg-XX/YY105 aa length, Ile-XX positionIntegral membrane proteinThermostable variant

This approach has been successfully applied to other membrane proteins in S. denitrificans, such as the SQRs, where functional homologs were identified and characterized despite sequence variations .

How can researchers address issues with recombinant nuoK expression and purification?

Membrane proteins like nuoK present unique challenges during recombinant expression and purification. Here are methodological approaches to address common issues:

  • Low expression yields:

    • Optimize codon usage for the expression host

    • Test different expression vectors with varying promoter strengths

    • Evaluate multiple E. coli strains specialized for membrane protein expression (C41(DE3), C43(DE3), etc.)

    • Consider fusion partners that enhance membrane protein expression (e.g., Mistic, GFP)

    • Optimize induction conditions: lower temperature (16-20°C), reduced inducer concentration, extended expression time

  • Protein misfolding and aggregation:

    • Express at lower temperatures (16-20°C) to slow folding and reduce aggregation

    • Add chemical chaperones to the growth medium (e.g., glycerol, arginine, trehalose)

    • Co-express with molecular chaperones (GroEL/ES, DnaK/J)

    • Optimize cell lysis conditions to prevent aggregation during extraction

    • Test different detergents for solubilization: start with mild detergents (DDM, LMNG)

  • Purification challenges:

    • Optimize detergent concentration during solubilization and purification

    • Implement two-step purification strategy: IMAC followed by size exclusion chromatography

    • Include stabilizing agents in all buffers (glycerol, specific lipids)

    • Maintain pH conditions that prevent aggregation (typically pH 7.5-8.0)

    • Consider on-column refolding for proteins recovered from inclusion bodies

  • Activity preservation:

    • Identify lipids essential for function and include them during purification

    • Test reconstitution into nanodiscs or liposomes for functional studies

    • Minimize exposure to air if the protein is oxygen-sensitive

    • Include reducing agents if the protein contains critical cysteine residues

    • Optimize buffer composition based on stability screening

For recombinant S. denitrificans nuoK specifically, the recommended approach includes using E. coli as the expression system, adding an N-terminal His-tag for purification, and storing the purified protein in Tris/PBS-based buffer with 6% trehalose at pH 8.0 . These conditions have been shown to maintain the protein in a stable form suitable for structural and functional studies.

What experimental controls are essential when investigating nuoK mutations?

When investigating the effects of nuoK mutations on NADH-quinone oxidoreductase function, several critical experimental controls must be included:

  • Assembly controls:

    • Blue-native gel electrophoresis to verify complete assembly of the NDH-1 complex with the mutated nuoK subunit

    • Immunostaining with antibodies against multiple subunits to confirm proper incorporation

    • Size exclusion chromatography to verify complex integrity and homogeneity

    • These controls ensure that any observed functional defects are not simply due to failure of complex assembly

  • Expression level controls:

    • Western blot analysis to verify comparable expression levels between wild-type and mutant nuoK

    • qRT-PCR to confirm equivalent transcription rates

    • Normalization of activity data to protein amount to account for any minor variations in expression

  • Mutation specificity controls:

    • Conservative mutations (e.g., Glu→Asp) to test side chain length effects

    • Non-conservative mutations (e.g., Glu→Gln) to test charge effects

    • Double and single mutations to identify cooperative effects

    • Reversion mutations to confirm that observed effects are due to the intended mutation

  • Activity assay controls:

    • Measurement of both coupled and uncoupled activities to distinguish effects on electron transfer versus proton pumping

    • Use of specific inhibitors to confirm that measured activities are complex I-dependent

    • Parallel assays with wild-type enzyme under identical conditions

    • Technical replicates to ensure reproducibility and biological replicates to account for strain variability

  • Negative controls:

    • Mutations in non-conserved residues that are predicted to have minimal impact

    • Empty vector controls for complementation experiments

    • Enzyme assays in the absence of substrate to establish baseline measurements

How should researchers interpret contradictory data in nuoK functional studies?

When faced with contradictory data in nuoK functional studies, researchers should follow this methodological framework for interpretation:

  • Experimental variables assessment:

    • Compare protein preparation methods across studies (detergents, buffers, purification techniques)

    • Evaluate differences in activity assay conditions (pH, temperature, substrate concentrations)

    • Consider variations in expression systems and genetic backgrounds

    • Examine the presence/absence of additional subunits or reconstitution environments

  • Technical validation approach:

    • Reproduce the contradictory experiments within a single laboratory using identical samples

    • Systematically vary one condition at a time to identify the source of discrepancy

    • Apply multiple complementary techniques to measure the same parameter

    • Engage independent laboratories to verify critical findings

  • Statistical analysis framework:

    • Apply appropriate statistical tests to determine if differences are significant

    • Calculate effect sizes to assess the magnitude of contradictions

    • Perform power analysis to ensure sufficient sample sizes

    • Consider Bayesian approaches to integrate prior knowledge with new data4

  • Biological interpretation strategies:

    • Consider that contradictions may reflect genuine biological complexity

    • Evaluate whether differences reflect distinct functional states of the protein

    • Assess if environmental sensitivities may explain variable results

    • Examine evolutionary conservation patterns to prioritize which results likely reflect the native function

  • Resolution framework:

    • Develop new hypotheses that reconcile contradictory observations

    • Design experiments specifically targeting the source of contradiction

    • Consider that both observations may be correct under different conditions

    • Incorporate computational modeling to test mechanistic explanations

Example table for analyzing contradictory findings:

ObservationStudy A FindingsStudy B FindingsPotential Reconciliation
Glu-36 roleEssential for proton pumpingMinimal effect on activityDifferent detergents affecting conformation
nuoK-membrane associationTightly integratedLoosely associatedpH-dependent membrane interaction
Conservation patternHighly conservedVariable across speciesFunction-specific conservation in key domains
Activity dependenceNADH-dependentAlternative electron donor compatibilityOrganism-specific metabolic adaptations

This systematic approach helps researchers distinguish between technical artifacts and genuine biological complexity, ultimately leading to a more nuanced understanding of nuoK function in different contexts.

What statistical approaches are recommended for analyzing nuoK mutational studies?

For rigorous analysis of nuoK mutational studies, the following statistical methodologies are recommended:

  • Descriptive statistics foundation:

    • Report means, standard deviations, and standard errors for all activity measurements

    • Use coefficient of variation (CV) to assess reliability of measurements

    • Present data in standardized formats (e.g., percent of wild-type activity)

    • Include sample sizes and number of independent biological replicates

  • Inferential statistics framework:

    • Apply Student's t-test for pairwise comparisons between wild-type and single mutants

    • Use ANOVA followed by post-hoc tests (Tukey, Bonferroni) for multiple mutant comparisons

    • Implement non-parametric alternatives (Mann-Whitney U, Kruskal-Wallis) if normality assumptions are violated

    • Consider mixed-effects models to account for batch effects and repeated measurements

  • Advanced analytical approaches:

    • Apply principal component analysis (PCA) to identify patterns across multiple functional parameters

    • Use hierarchical clustering to group mutations with similar functional profiles

    • Implement regression models to quantify structure-function relationships

    • Consider machine learning approaches for complex datasets with multiple variables

  • Visualization strategies:

    • Create forest plots to compare effect sizes across different mutations

    • Use heatmaps to visualize multiple parameters across numerous mutations

    • Develop scatter plots with error bars to show relationships between different functional measures

    • Create table formats that aid visual comparison of statistical significance4

Example statistical table format for reporting mutational data:

MutationElectron Transfer ActivityProton Pumping ActivityStatistical Comparison
% of WT (Mean ± SD)n% of WT (Mean ± SD)np-value (vs. WT)
Wild-type100.0 ± 5.212100.0 ± 6.112-
Glu36Asp47.6 ± 4.3917.2 ± 3.89p < 0.001
Glu36Gln12.3 ± 3.194.1 ± 2.29p < 0.001
Glu72Asp62.4 ± 5.7932.6 ± 4.39p < 0.001
Glu72Gln37.2 ± 4.9912.7 ± 3.89p < 0.001

These statistical approaches ensure robust interpretation of experimental data and facilitate comparison across different studies. When creating statistical tables for research papers, it's important to ensure they are well-formatted with clear column headers and appropriate spacing4.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.