Recombinant Sulfurimonas denitrificans Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Sulfurimonas denitrificans Protein CrcB Homolog

The CrcB protein in Sulfurimonas denitrificans is annotated as a putative fluoride ion transporter, playing roles in cellular ion homeostasis. Recombinant CrcB homologs are engineered for biochemical characterization, leveraging E. coli expression systems for high-yield production .

PropertyDetails
Gene NamecrcB (Suden_0486)
UniProt IDQ30TB5
Protein Length129 amino acids (Full-length)
Molecular FunctionPutative fluoride ion transport
Expression HostEscherichia coli
TagN-terminal His tag
Purity>90% (SDS-PAGE verified)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0

Recombinant Production and Purification

  • Expression System: Heterologous expression in E. coli ensures scalability, with yields typically optimized for research-grade applications .

  • Purification: Affinity chromatography (Ni-NTA) via the His tag enables efficient isolation.

  • Storage: Lyophilized powder stable at -20°C/-80°C; reconstitution in Tris/PBS buffer with 50% glycerol is recommended for long-term stability .

Functional Insights

While direct functional assays for S. denitrificans CrcB are not publicly documented, homologs in other bacteria (e.g., E. coli CrcB) mediate fluoride resistance by exporting intracellular F⁻ ions. Key inferred properties include:

  • Fluoride Transport: Likely operates via a proton gradient-dependent mechanism.

  • Membrane Localization: Predicted to be membrane-associated due to hydrophobic regions in its sequence .

Research Applications

  • Ion Transport Studies: Used to dissect fluoride homeostasis mechanisms in extremophiles.

  • Structural Biology: Serves as a template for crystallography or cryo-EM to resolve ion channel architectures.

  • Biotechnological Engineering: Potential applications in fluoride biosensing or bioremediation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
crcB; Suden_0486; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) (Thiomicrospira denitrificans (strain ATCC 33889 / DSM 1251))
Target Names
crcB
Target Protein Sequence
MSWQTILAIGSGGFIGAVLRAYFNGIISHKMPHDIPFGTLGVNLVGSFIMGILIAYFMYS TIFSLHVKSFLSTGVLGALTTYSTFAIESFLLLNSGHIALALANISLNAFGSILMAGGGF YIIKLSLRA
Uniprot No.

Target Background

Function
CrcB homolog plays a crucial role in reducing fluoride concentration within cells, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the evolutionary significance of CrcB homologs in bacterial systems?

CrcB homologs are widely distributed across bacterial species and represent an important family of membrane proteins involved in ion transport. Understanding the evolutionary relationships between CrcB homologs requires sophisticated computational approaches. Network propagation algorithms have proven particularly effective for identifying remote protein homologs that might be missed by simple pairwise alignment approaches .

Research indicates that family-based methods can infer nearly three times as many homologies as simple pairwise alignment algorithms at a given false positive rate . This suggests that CrcB has evolved with significant structural conservation across bacterial species despite potential sequence divergence, indicating its biological importance.

What are the optimal storage and reconstitution protocols for recombinant CrcB protein?

For optimal results with recombinant CrcB protein, follow these evidence-based storage and reconstitution protocols:

Storage Recommendations:

  • Store the lyophilized powder at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended default: 50%)

  • Aliquot for long-term storage at -20°C/-80°C

How can network propagation algorithms enhance identification of CrcB homologs across diverse species?

Network propagation algorithms like RANKPROP offer significant advantages over traditional BLAST and PSI-BLAST approaches when identifying remote CrcB homologs. These algorithms build upon the concept that protein similarity networks contain valuable global information that can identify homology relationships missed by pairwise comparisons .

Methodological Approach:

  • Construct a protein similarity network where nodes represent proteins and edges represent similarity scores

  • Apply a diffusion operation that propagates similarity information through the network

  • Re-rank potential homologs based on global network information rather than just direct pairwise scores

Research has demonstrated that for a given false positive rate, these network-based methods allow researchers to infer nearly three times as many homologies as simple pairwise alignment algorithms . When applied to CrcB research, this approach can identify functionally related proteins across diverse bacterial phyla that may share structural and functional properties despite low sequence identity.

What experimental approaches are recommended for studying CrcB's putative role in fluoride ion transport?

To investigate CrcB's putative function as a fluoride ion transporter, consider these methodological approaches:

Fluoride Transport Assays:

  • Liposome Reconstitution: Purified CrcB protein can be reconstituted into liposomes loaded with fluoride-sensitive probes to directly measure transport activity

  • Membrane Vesicle Studies: Create inside-out or right-side-out membrane vesicles from E. coli expressing CrcB to measure fluoride transport across membranes

  • Electrophysiological Measurements: Apply patch-clamp techniques to characterize the ion selectivity and gating properties of CrcB channels

Mutational Analysis:

  • Create systematic mutations in conserved regions of the protein

  • Express mutant proteins in fluoride-sensitive E. coli strains lacking endogenous fluoride transporters

  • Assess changes in fluoride resistance to identify critical residues for transport function

How does the Sulfurimonas denitrificans CrcB compare structurally to other bacterial fluoride transporters?

While specific structural data for Sulfurimonas denitrificans CrcB is limited, computational approaches can provide valuable insights:

Comparative Structural Analysis Methods:

  • Homology Modeling: Generate a structural model of S. denitrificans CrcB based on available crystal structures of homologous proteins

  • Molecular Dynamics Simulations: Simulate the behavior of the protein within a lipid bilayer to predict ion transport mechanisms

  • Sequence-Structure Networks: Apply network propagation algorithms to identify structurally conserved regions across diverse CrcB homologs

Protein structure prediction methods can be enhanced using the RANKPROP algorithm, which has been shown to outperform both BLAST and PSI-BLAST in identifying remote homologs that share structural features despite sequence divergence .

How can I resolve issues with protein aggregation during CrcB reconstitution?

Protein aggregation is a common challenge when working with membrane proteins like CrcB. Consider these evidence-based solutions:

Preventing Aggregation:

  • Optimize Buffer Composition:

    • Use Tris/PBS-based buffer with pH 8.0 as recommended in the product specifications

    • Include stabilizing agents such as the 6% Trehalose indicated in the storage buffer

    • Experiment with mild detergents (DDM, CHAPS) at concentrations just above their critical micelle concentration

  • Reconstitution Protocol Modifications:

    • Perform reconstitution at 4°C rather than room temperature

    • Use gradual dilution methods to slowly remove detergents

    • Consider adding lipids that match the native membrane environment of Sulfurimonas denitrificans

  • Quality Control Methods:

    • Use dynamic light scattering to monitor aggregation state

    • Apply size exclusion chromatography to separate functional protein from aggregates

    • Verify protein folding using circular dichroism spectroscopy

What approaches are recommended for analyzing contradictory results in CrcB functional studies?

When facing contradictory results in CrcB functional studies, apply this systematic troubleshooting framework:

Data Reconciliation Strategy:

  • Experimental Condition Analysis:

    • Create a comprehensive table comparing all experimental variables across contradictory studies

    • Systematically test whether differences in protein preparation, buffer composition, or assay conditions explain discrepancies

  • Multiple Assay Validation:

    • Verify functional findings using at least three independent methodological approaches

    • For example, combine fluoride binding assays, transport studies, and in vivo complementation tests

  • Advanced Statistical Analysis:

    • Apply receiver operating characteristic (ROC) analysis similar to that used in protein homology detection

    • Calculate confidence intervals for all quantitative measurements

    • Consider Bayesian approaches to integrate contradictory datasets

How might high-throughput protein network analysis advance our understanding of CrcB function?

The application of protein network analysis to CrcB research represents a promising frontier with several methodological approaches:

Advanced Network Analysis Methods:

  • Network Propagation Algorithms:

    • Apply RANKPROP and related algorithms to identify functional partners of CrcB

    • Use Markov clustering-based approaches (MCL) to identify protein communities functionally related to CrcB

    • Implement MOTIFPROP algorithms that leverage shared sequence motifs to capture cluster structure among proteins

  • Quantitative Assessment:

    • Evaluate network predictions using ROC scores to determine accuracy of functional associations

    • Compare performance across different network construction methods using benchmark datasets

    • Integrate multiple networks (sequence similarity, co-expression, protein-protein interaction) for more robust predictions

These approaches can reveal previously unrecognized functional relationships between CrcB and other cellular components, potentially uncovering new biological roles beyond fluoride transport.

What methodological advances could improve structural characterization of membrane proteins like CrcB?

Recent technological developments offer new opportunities for structural characterization of challenging membrane proteins like CrcB:

Emerging Structural Biology Approaches:

  • Cryo-EM for Membrane Proteins:

    • Single-particle cryo-EM can now achieve near-atomic resolution for membrane proteins

    • Sample preparation techniques using nanodiscs or amphipols maintain native-like lipid environments

    • Classification algorithms can resolve conformational heterogeneity that may be critical for understanding transport mechanisms

  • Integrative Structural Biology:

    • Combine low-resolution structural data with computational modeling

    • Cross-link mass spectrometry to identify distance constraints

    • Incorporate evolutionary coupling analysis to identify co-evolving residues that likely interact functionally

  • In-cell Structural Studies:

    • Develop methods to study CrcB structure in its native cellular environment

    • Apply emerging techniques like in-cell NMR or cryo-electron tomography

    • Correlate structural findings with functional measurements in the same cellular systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.