Recombinant Sulfurovum sp. NADH-quinone oxidoreductase subunit K (nuoK)

What is NADH-quinone oxidoreductase subunit K (nuoK) in Sulfurovum sp.?

NADH-quinone oxidoreductase subunit K (nuoK) is a critical transmembrane protein component of the NADH dehydrogenase complex (Complex I) in the respiratory chain of Sulfurovum species. In Sulfurovum sp., particularly strain NBC37-1, nuoK functions as part of the proton-translocating NADH-quinone oxidoreductase system (EC 1.6.99.5) . This complex plays a vital role in energy conservation through electron transfer processes. The protein consists of approximately 100 amino acids and contains multiple transmembrane domains that anchor it within the cytoplasmic membrane . The full amino acid sequence of Sulfurovum sp. nuoK includes: "MIGLSHYLIVSALIFIGLMGVLRRRLLMLFFATEVMLNAVNIAFAAISHYYNDLTGQMFAFFIIAIAASEVAVGLGILIVLYKRYGSLDLDDLASMKG" .

How does nuoK contribute to the respiratory electron transport chain?

The nuoK subunit functions as an integral part of the NADH-quinone oxidoreductase complex, which serves as the entry point for electrons into the respiratory chain. This complex facilitates electron transfer from NADH to quinones (likely ubiquinone in Sulfurovum species) . For every two electrons transferred through this system, approximately four hydrogen ions are translocated across the cytoplasmic membrane, thereby conserving redox energy in the form of a proton gradient .

In the complete electron transport chain, nuoK works in coordination with other subunits to couple the oxidation of NADH to NAD+ with the reduction of quinone to quinol. This process generates a proton motive force that drives ATP synthesis. Specifically in Sulfurovum sp., this process is particularly important under microaerobic conditions where it may integrate with denitrification processes, allowing for metabolic flexibility in sulfide-rich environments .

What experimental challenges are associated with recombinant nuoK production?

Producing recombinant nuoK presents several experimental challenges that researchers should anticipate:

• Membrane protein expression barriers: As a transmembrane protein, nuoK is inherently difficult to express in soluble, functional form using standard recombinant protein expression systems.

• Expression system selection: Cell-free expression systems have proven effective for producing recombinant transmembrane proteins like nuoK . These systems bypass cellular toxicity issues that often occur when overexpressing membrane proteins.

• Purification complications: The hydrophobic nature of nuoK requires specialized detergent-based extraction and purification protocols to maintain protein stability and native conformation.

• Storage considerations: Recombinant nuoK requires specific buffer conditions (typically Tris-based buffers with 50% glycerol) and should be stored at -20°C or -80°C for extended preservation . Repeated freeze-thaw cycles should be avoided.

• Functional verification: Confirming proper folding and functionality of recombinant nuoK requires specialized assays that can assess membrane integration and electron transfer capabilities.

What are the structural characteristics of nuoK in Sulfurovum sp.?

The nuoK subunit in Sulfurovum sp. displays several key structural characteristics:

• Size and composition: The full-length protein consists of 100 amino acids with a molecular mass of approximately 11 kDa .

• Transmembrane domains: Analysis of the amino acid sequence reveals multiple hydrophobic regions that form transmembrane helices, which anchor the protein in the cytoplasmic membrane.

• Conserved regions: The protein contains highly conserved residues that are crucial for interaction with other subunits of the NADH-quinone oxidoreductase complex.

• Functional domains: While the complete three-dimensional structure of Sulfurovum sp. nuoK has not been fully elucidated, homology studies suggest it contains regions involved in proton translocation and interaction with other membrane subunits of the complex.

The transmembrane nature of nuoK positions it ideally for its role in coupling electron transfer to proton translocation across the membrane, contributing to the chemiosmotic gradient that drives ATP synthesis in these bacteria.

How does the function of nuoK in Sulfurovum sp. relate to the organism's adaptation to sulfide-rich environments?

The nuoK subunit plays a crucial role in Sulfurovum sp.'s remarkable adaptation to sulfide-rich environments through several mechanisms:

Sulfurovum sp., particularly strain NBC37-1, is a chemolithoautotrophic bacterium that thrives in sulfide-rich marine environments . The NADH-quinone oxidoreductase complex containing nuoK serves as a critical component in the organism's energy conservation system, particularly under microaerobic conditions where alternative electron acceptors become important.

Research indicates that Sulfurovum sp. can oxidize thiosulfate through the rDsr pathway while simultaneously performing denitrification under microaerobic conditions . Electrons generated during sulfur oxidation may be transferred to NAD+ to produce NADH, which feeds into the respiratory chain where nuoK functions. This creates a sophisticated electron transfer network that allows Sulfurovum to utilize both sulfur compounds and nitrogen oxides in energy metabolism.

Under microaerobic conditions (2 vol% initial atmospheric O2), the presence of thiosulfate has been shown to stimulate growth rates in Sulfurovum sp., demonstrating the importance of this metabolic pathway in the organism's adaptation strategy . The integration of sulfur oxidation with the respiratory chain containing nuoK allows Sulfurovum to efficiently utilize available energy sources in its natural habitat.

This metabolic flexibility, where nuoK participates in electron transfer processes linked to both aerobic respiration and denitrification, represents a key adaptation that allows Sulfurovum to dominate in sulfide-rich niches where other organisms cannot survive.

What methodologies are most effective for studying nuoK function in respiratory complexes?

To effectively study nuoK function within respiratory complexes, researchers should consider the following methodological approaches:

• Photoaffinity labeling techniques: Using photoaffinity ligands such as (trifluoromethyl)diazirinyl[3H]pyridaben ([3H]TDP) has proven effective for studying subunit interactions in NADH-quinone oxidoreductases . This approach can identify binding sites and protein-protein interactions involving nuoK.

• Inhibitor binding studies: Competitive binding studies using inhibitors such as rotenone, piericidin A, bullatacin, and pyridaben can provide insights into functional domains of nuoK . These studies can be coupled with enzyme inhibition assays to correlate binding with functional effects.

• Recombinant expression systems: Cell-free expression systems have been shown to successfully produce functional transmembrane proteins like nuoK . These systems allow for the incorporation of modified amino acids or isotopic labeling for structural studies.

• Site-directed mutagenesis: Systematic mutation of conserved residues in nuoK can identify key amino acids involved in protein-protein interactions, proton translocation, or electron transfer.

• Comparative genomics and proteomics: Analysis of nuoK sequence conservation across different species can identify functionally important regions. Proteomic approaches can reveal post-translational modifications that affect function.

• Transcriptomic analysis: RNA-seq studies under different growth conditions can reveal how nuoK expression changes in response to environmental factors, providing insights into its physiological role .

• Electron paramagnetic resonance (EPR) spectroscopy: This technique can be used to study the electron transfer properties of iron-sulfur clusters near the nuoK subunit in the respiratory complex.

How does the electron transfer mechanism involving nuoK differ between aerobic and microaerobic conditions?

The electron transfer mechanisms involving nuoK in Sulfurovum sp. show significant differences between aerobic and microaerobic conditions:

Under aerobic conditions, the NADH-quinone oxidoreductase complex containing nuoK primarily transfers electrons from NADH to ubiquinone, contributing to the standard aerobic respiratory chain. The proton gradient generated through this process drives ATP synthesis through oxidative phosphorylation.

In contrast, under microaerobic conditions (2 vol% initial atmospheric O2), Sulfurovum sp. demonstrates a more complex electron transfer network. Research has shown that genes involved in denitrification show significantly increased transcript levels when thiosulfate is present under microaerobic conditions . This suggests that electrons from thiosulfate oxidation can be channeled through the NADH-quinone oxidoreductase complex to support denitrification.

Specifically, under microaerobic conditions with thiosulfate present, transcriptomic analysis has revealed upregulation of genes encoding various components of denitrification, including transporters for nitrate and nitrite (NarK), respiratory nitrate reductase (NarGHJ), and maturation proteins for reductases involved in the denitrification pathway . This upregulation corresponds with more rapid reduction of nitrate and depletion of nitrite in cultures containing thiosulfate.

The nuoK subunit's role in this alternative electron flow appears critical for energy conservation under oxygen-limited conditions, allowing Sulfurovum to maintain efficient energy production by coupling thiosulfate oxidation with nitrate reduction. This metabolic flexibility represents a sophisticated adaptation to the variable redox conditions encountered in sulfide-rich marine environments.

What role does nuoK play in proton translocation mechanisms of respiratory complex I?

The nuoK subunit plays a critical role in the proton translocation mechanism of respiratory complex I through several specialized functions:

• Channel formation: As a transmembrane protein, nuoK contributes to forming hydrophilic channels that facilitate proton movement across the membrane. The specific arrangement of transmembrane helices creates pathways for proton translocation.

• Conformational coupling: Evidence suggests that nuoK participates in the conformational changes that couple electron transfer from iron-sulfur clusters to proton translocation. This long-range energy coupling is essential for the proton pumping mechanism .

• Proton-to-electron ratio: nuoK contributes to maintaining the efficiency of complex I, which typically translocates four protons for every two electrons transferred from NADH to quinone . This fixed stoichiometry is crucial for energy conservation.

• Interaction with other membrane subunits: nuoK functions in coordination with other membrane subunits of complex I to create a complete proton translocation pathway. Structural studies of related systems suggest that nuoK lies within the membrane arm of the complex, where proton pumping occurs.

Research using inhibitors that target specific binding sites has shown that disruption of these sites can inhibit both electron transfer and proton translocation, supporting the critical role of nuoK in maintaining the functional coupling between these processes . The ability of nuoK to participate in this sophisticated energy conversion mechanism is fundamental to the bioenergetics of Sulfurovum sp. and related bacteria.

How can researchers effectively analyze the interaction between nuoK and quinones?

Researchers can effectively analyze the interaction between nuoK and quinones using the following methodological approaches:

These methodological approaches, used in combination, can provide comprehensive insights into how nuoK interacts with quinones to facilitate electron transfer in the respiratory chain of Sulfurovum sp. This understanding is crucial for elucidating the bioenergetic mechanisms that allow these bacteria to thrive in challenging sulfide-rich environments.

What expression systems are most suitable for recombinant nuoK production?

The selection of an appropriate expression system is critical for successful recombinant nuoK production. Based on the available data and established protocols for similar membrane proteins, the following systems have proven effective:

• Cell-free expression systems: These have been successfully used for nuoK production, as evidenced by commercial recombinant products . Cell-free systems bypass the cellular toxicity often associated with membrane protein overexpression and allow for the incorporation of specialized lipids or detergents that maintain protein stability.

• Bacterial expression systems with specialized vectors: Modified E. coli strains (such as C41(DE3) or C43(DE3)) developed specifically for membrane protein expression can be used with vectors containing regulatable promoters that prevent toxic levels of expression.

• Expression as fusion proteins: Creating fusions with soluble partners like maltose-binding protein (MBP) or thioredoxin can improve folding and solubility of nuoK during expression.

• Yeast expression systems: Pichia pastoris or Saccharomyces cerevisiae can provide a eukaryotic membrane environment that may better support proper folding of complex membrane proteins like nuoK.

For optimal results, expression conditions should be carefully optimized with respect to temperature, induction timing, and media composition. Expression should be verified using techniques like Western blotting with specific antibodies against nuoK or against fusion tags incorporated into the recombinant construct.

What purification strategies are most effective for recombinant nuoK?

Purifying recombinant nuoK requires specialized approaches due to its transmembrane nature. The following strategies have proven effective for similar proteins:

• Detergent solubilization: Carefully selected detergents (like n-dodecyl-β-D-maltoside or digitonin) can extract nuoK from membranes while maintaining structural integrity. The choice of detergent is critical and may require screening multiple options.

• Affinity chromatography: Incorporating affinity tags (His-tag, FLAG-tag, etc.) into recombinant nuoK enables efficient one-step purification using appropriate affinity resins. Current commercial preparations likely utilize this approach .

• Size exclusion chromatography: This technique can separate properly folded nuoK from aggregates and can also provide information about the oligomeric state of the protein.

• Ion exchange chromatography: This can be used as an additional purification step, particularly when high purity is required for structural studies.

• Buffer optimization: Maintaining protein stability during purification requires optimized buffers containing glycerol (typically 50%) and appropriate salt concentrations . For long-term storage, proteins should be kept at -20°C or -80°C, with working aliquots stored at 4°C for up to one week .

Purification success should be monitored using SDS-PAGE, Western blotting, and activity assays specific to nuoK function. Mass spectrometry can confirm protein identity and integrity.

What analytical methods can verify the structural integrity of purified recombinant nuoK?

Verifying the structural integrity of purified recombinant nuoK is essential before proceeding with functional studies. The following analytical methods are recommended:

These complementary approaches provide a comprehensive assessment of structural integrity, guiding researchers in optimizing expression and purification conditions to obtain properly folded, functional recombinant nuoK.

How can recombinant nuoK be used to study bacterial bioenergetics?

Recombinant nuoK offers several valuable approaches for studying bacterial bioenergetics:

• Reconstitution experiments: Purified recombinant nuoK can be incorporated into proteoliposomes along with other respiratory chain components to reconstruct functional electron transport systems. This allows researchers to study proton translocation efficiency and electron transfer rates in controlled environments.

• Inhibitor binding studies: Recombinant nuoK can be used to screen for novel inhibitors of respiratory complex I and characterize binding affinities. This approach has been successfully employed with related subunits like PSST, which couples electron transfer from iron-sulfur cluster N2 to quinone .

• Site-directed mutagenesis: Generating variants of recombinant nuoK with specific amino acid substitutions allows researchers to identify residues critical for electron transfer, proton translocation, or subunit interactions. This approach provides mechanistic insights into complex I function.

• Interspecies comparative studies: Comparing the properties of nuoK from Sulfurovum sp. with homologous proteins from other bacteria can reveal adaptations that support energy conservation in different ecological niches. Such comparisons help elucidate evolutionary adaptations in respiratory chains.

• Structural studies: Recombinant nuoK can contribute to structural determination of complex I components, particularly when combined with other subunits. This information is crucial for understanding the molecular mechanisms of energy conservation.

These applications collectively enhance our understanding of bacterial respiratory chains and energy conservation mechanisms, with potential implications for understanding similar processes in mitochondria.

What role does nuoK play in sulfur metabolism of Sulfurovum sp.?

The nuoK subunit plays a significant though indirect role in the sulfur metabolism of Sulfurovum sp. through its participation in energy conservation pathways:

Sulfurovum sp., particularly strain NBC37-1, is known to utilize reduced sulfur compounds as electron donors for energy conservation . Under microaerobic conditions, Sulfurovum sp. can oxidize thiosulfate, with electrons potentially being directed to the respiratory chain where nuoK functions .

Research has demonstrated that thiosulfate oxidation in Sulfurovum sp. can result in the formation of tetrathionate as an intermediate product. Under microaerobic conditions, approximately 10 mM of supplied thiosulfate was consumed within 16 hours, with about 3.76 mM tetrathionate accumulating . This oxidation process generates electrons that can enter the respiratory chain.

The integration of sulfur oxidation pathways with the respiratory chain containing nuoK allows Sulfurovum sp. to efficiently couple the oxidation of reduced sulfur compounds to energy conservation. Transcriptomic analyses have shown that genes involved in sulfur oxidation through the rDsr pathway are significantly upregulated under microaerobic conditions in the presence of thiosulfate .

Furthermore, electrons derived from sulfur oxidation can be transferred to NAD+ via proteins like DsrL, generating NADH that feeds into the NADH-quinone oxidoreductase complex containing nuoK . This creates a sophisticated electron transfer network that connects sulfur oxidation to respiratory energy conservation.

How can researchers use inhibitor studies with recombinant nuoK to understand electron transport mechanisms?

Inhibitor studies with recombinant nuoK provide powerful tools for understanding electron transport mechanisms through several methodological approaches:

• Photoaffinity labeling with inhibitor analogs: Researchers can use photoactivatable inhibitor analogs like (trifluoromethyl)diazirinyl[3H]pyridaben ([3H]TDP) to identify specific binding sites on nuoK . This approach has successfully localized inhibitor binding sites in homologous subunits of complex I.

• Structure-activity relationship (SAR) studies: Testing a series of structurally related inhibitors with recombinant nuoK can identify chemical features essential for binding. Inhibitors like rotenone, piericidin A, bullatacin, and pyridaben, which show different potencies, can help map the binding pocket topology .

• Competition binding assays: Using labeled inhibitors in competition with unlabeled compounds can determine binding affinities and kinetics. This approach has revealed that inhibitor binding to PSST (a functionally related subunit) is exceptionally sensitive to high-potency inhibitors, suggesting a conserved binding mechanism .

• Coupling inhibitor binding to functional assays: Correlating inhibitor binding with effects on electron transfer activity provides insights into the functional significance of specific protein regions. This approach can identify which parts of nuoK are directly involved in electron transport.

• Cross-linking studies: Photoactivatable inhibitors can be used to covalently link to nearby subunits, mapping the protein environment around nuoK and identifying interacting partners involved in electron transfer.

These inhibitor-based approaches have revealed that homologous subunits of complex I in mitochondria (PSST) and bacteria (NQO6) share a conserved inhibitor-binding site that plays a key role in electron transfer by functionally coupling iron-sulfur cluster N2 to quinone . Similar studies with recombinant nuoK from Sulfurovum sp. could provide specific insights into how this organism's respiratory chain has adapted to its unique ecological niche.

What are the most promising areas for future research involving recombinant nuoK?

Future research involving recombinant Sulfurovum sp. nuoK holds significant promise in several key areas:

• Structural biology: Determining the high-resolution structure of nuoK alone and within the context of the complete respiratory complex would significantly advance our understanding of electron transfer and proton translocation mechanisms. Cryo-electron microscopy combined with other structural techniques presents a promising approach.

• Bioenergetic adaptations to extreme environments: Comparative studies of nuoK from Sulfurovum sp. with homologous proteins from other extremophiles could reveal adaptations that support energy conservation in challenging environments. This research direction has implications for understanding bacterial evolution and adaptation.

• Development of specific inhibitors: Structure-based design of inhibitors specific to nuoK could provide valuable tools for studying respiratory chain function in Sulfurovum sp. and related bacteria. These inhibitors could also help elucidate the role of complex I in bacterial pathogenesis.

• Integration with synthetic biology: Incorporating recombinant nuoK into synthetic respiratory chains could enable the development of engineered bacteria with enhanced bioenergetic capabilities for biotechnological applications.

• Examining nuoK's role in denitrification: Further research into how nuoK participates in coupled sulfur oxidation and denitrification pathways could provide insights into Sulfurovum's remarkable metabolic flexibility under microaerobic conditions .

• Protein-protein interaction mapping: Comprehensive analysis of nuoK's interactions with other respiratory complex components could reveal regulatory mechanisms that modulate electron transfer efficiency in response to environmental conditions.

These research directions collectively promise to enhance our understanding of bacterial bioenergetics and potentially inspire biomimetic approaches to energy conversion technologies.

How might understanding nuoK function contribute to biotechnological applications?

Understanding nuoK function in Sulfurovum sp. could contribute to several innovative biotechnological applications:

• Bioremediation technologies: The role of nuoK in the respiratory chain that supports sulfur compound oxidation makes it relevant for developing enhanced bioremediation strategies for sulfide-contaminated environments. Engineering bacteria with optimized nuoK-containing respiratory chains could improve their efficacy in transforming toxic sulfur compounds.

• Bioelectrochemical systems: Insights into electron transfer mechanisms involving nuoK could inform the development of microbial fuel cells that utilize chemolithoautotrophic bacteria for electricity generation. Sulfurovum sp. with its ability to oxidize sulfur compounds presents an interesting candidate for such applications.

• Biosensors for environmental monitoring: Understanding the molecular mechanisms of nuoK involvement in respiratory responses to varying oxygen levels and sulfur compounds could lead to the development of whole-cell biosensors for detecting environmental contaminants.

• Enzyme engineering: Structural and functional insights into nuoK could guide the engineering of more efficient respiratory complexes with enhanced electron transfer capabilities or altered substrate specificities.

• Biomimetic catalysis: The electron transfer mechanisms involving nuoK could inspire the development of synthetic catalysts that mimic biological electron transfer efficiency for industrial applications.

• Drug development targets: While Sulfurovum sp. is not pathogenic, understanding nuoK function could provide insights into respiratory chain components in pathogenic bacteria, potentially identifying new antibiotic targets.

These applications highlight the potential for fundamental research on nuoK to translate into practical biotechnological solutions addressing environmental challenges and sustainable energy production.