Recombinant Sulfurovum sp. Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
htpX; SUN_0433; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Sulfurovum sp. (strain NBC37-1)
Target Names
htpX
Target Protein Sequence
MEQFKTYALMTGLTLLFIWFGGMIAGQTGMVIAFLVAAGMNFYAYYYSDQQVLSHYHAEP VDRAHASGLYQIVEKLTRRAGLPMPALYIIPEQQPNAFATGRNYEHAAVAVTEGLLDLMT DEEIEAVIAHELSHIKHYDMLIGTVAATIAGAIAMLANFGMFFGSGDRDRPNIFVMLALM FIMPMAASIIQMTVSRNREFMADEGSARMTGHPEWLQSALTKLDNYARSITLPEADPQTA HMFIINPFSGKDVSLKQLFSTHPSTEARIERLEALK
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Sulfurovum sp. Protease HtpX homolog (htpX)?

Recombinant Sulfurovum sp. Protease HtpX homolog (htpX) is an integral membrane metallopeptidase that plays a critical role in protein quality control by preventing the accumulation of misfolded proteins in the membrane . The full-length protein consists of 276 amino acids and can be expressed with various tags, such as N-terminal His tags, for purification purposes . The protein is encoded by the htpX gene, which produces a 909 bp coding sequence in certain species . Structurally, the protein contains peptidase M48 domains (amino acids 87-289) and metalloprotease (zincin) catalytic domains, making it functionally similar to other proteases involved in protein degradation pathways .

What are the optimal reaction conditions for HtpX protease activity?

Based on experimental data, the HtpX protease demonstrates the following optimal conditions:

  • Temperature: The optimal reaction temperature is 45°C, which doubles the enzyme activity compared to 30°C. The enzyme activity significantly decreases at temperatures above 60°C .

  • Temperature stability: The enzyme shows strong temperature tolerance, maintaining over 90% activity after 8 hours at 50°C, but activity severely decreases after 8 hours at 60°C .

  • pH: The optimal pH is 7, with relatively high activity maintained within the pH 7-9 range .

  • pH stability: The enzyme activity preservation rate is highest after storage in pH 6 buffer for 8 hours, but inactivation occurs more severely under more acidic or alkaline conditions .

These characteristics identify the HtpX protease as a neutral and heat-resistant enzyme, making it potentially valuable for various research applications requiring these properties.

How can the htpX gene be cloned and expressed in heterologous systems?

For successful cloning and expression of the htpX gene, researchers should follow this methodology:

  • Primer design: Design primers containing appropriate restriction endonuclease sites (e.g., BamHI and SmaI) based on the htpX gene sequence. For example:

    • Forward primer (P1): 5′-CGGATCCTGCTGCTAAAACATTCACTGTT-3′

    • Reverse primer (P2): 5′-TCCCCGGGTTTATAGGAATGCAAGCGC-3′

  • PCR amplification: Use genomic DNA from the source organism (e.g., strain DX-3) as a template for PCR amplification of the htpX gene .

  • Vector preparation: Digest an appropriate expression vector (e.g., pHT43) with the same restriction enzymes (BamHI and SmaI) at 16°C .

  • Ligation and transformation:

    • Ligate the digested PCR product with the treated vector using T4 ligase (overnight reaction)

    • Transform the ligation mixture into a cloning strain (e.g., E. coli DH5α)

    • Validate correct transformants through bacterial PCR and sequencing

  • Expression host transformation:

    • For improved transformation efficiency, transform the validated recombinant plasmid into E. coli BL21(DE3)

    • For final expression, transform into an appropriate host (e.g., Bacillus subtilis WB800N) using electroporation

    • Select transformants on appropriate antibiotic-containing media (e.g., LB plates with chloramphenicol)

  • Protein expression:

    • Culture the engineered strain in appropriate media with antibiotics to OD600 ≈ 0.6–0.8

    • Induce protein expression with IPTG (1 mM final concentration)

    • Harvest the cells by centrifugation and analyze the supernatant or cell lysate by SDS-PAGE

This methodology has been demonstrated to achieve successful expression of active recombinant HtpX protease.

What purification strategies are effective for obtaining high-quality recombinant HtpX?

For purification of recombinant HtpX, a multi-step chromatographic approach has proven effective:

  • Membrane extraction: As HtpX is an integral membrane protein, it must first be extracted from membranes using appropriate detergents. Octyl-β-d-glucoside has been successfully employed for this purpose .

  • Three-step purification process:

    • Cobalt-affinity chromatography: Utilizing the His-tag (typically C-terminal His8-tag) for initial capture and purification

    • Anion-exchange chromatography: Further purification based on the protein's charge properties

    • Size-exclusion chromatography: Final polishing step to achieve homogeneity

  • Buffer considerations: Maintain the appropriate detergent (e.g., octyl-β-d-glucoside) throughout the purification process to keep the membrane protein soluble and properly folded .

  • Storage recommendations:

    • Aliquot the purified protein to avoid repeated freeze-thaw cycles

    • Store working aliquots at 4°C for up to one week

    • Store long-term at -20°C/-80°C in appropriate buffer (e.g., Tris/PBS-based buffer with 6% Trehalose, pH 8.0)

    • Consider adding glycerol (5-50% final concentration) for long-term storage

  • Reconstitution protocol: When using lyophilized powder forms, briefly centrifuge the vial before opening, and reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

This purification strategy has been shown to yield milligram amounts of pure, well-folded protein suitable for subsequent structural and functional studies.

How does the 3D structure of HtpX relate to its catalytic function?

The 3D structure of the DX-3-htpX protease, as predicted using alphafold3, reveals important structural features that relate to its catalytic function:

  • Structural elements: The model consists of ten α-helices, four strands, two 310 helices, twelve turns, seven bends, and multiple coil regions, forming a complex tertiary structure that facilitates its proteolytic activity .

  • Active site organization: The active site of DX-3-htpX protease contains multiple amino acid residues that participate in substrate binding and catalysis. Key residues in the D3 pocket include ARG4, LEU7, PHE8, VAL11, and others as detailed in the table below .

  • Metal ion interactions: The binding of different ions (Ca2+, Zn2+, Cl-, and K+) to DX-3-htpX protease can significantly alter its 3D structure and active sites. These structural changes affect the size and characteristics of the active pocket, potentially modulating the enzyme's substrate specificity and catalytic efficiency .

The following table summarizes the effects of different ions on the active site characteristics:

Protease FormActive Pocket Area (Ų)Active Pocket Volume (ų)Number of Active Site Residues
HtpX alone557.472837.24141
HtpX-Ca²⁺918.1541378.22138
HtpX-Cl⁻714.286867.36439
HtpX-K⁺925.5441335.23743
HtpX-Zn²⁺811.0231179.12739

These data demonstrate that Ca²⁺ binding to the DX-3-htpX protease results in the largest active pocket (918.154 Ų area, 1378.221 ų volume), which may enhance substrate accessibility and catalytic efficiency .

What are the comparative enzymatic properties of recombinant HtpX versus native HtpX?

Comparative analysis of the recombinant DX-3-htpX protease versus the native DX-3 protease reveals significant differences in enzymatic properties:

These differences highlight the potential advantages of using recombinant HtpX for research applications, particularly when higher enzyme activity and improved stability are required.

How can researchers troubleshoot expression and purification issues with recombinant HtpX?

When working with recombinant HtpX, researchers may encounter various challenges. Here are methodological approaches to address common issues:

  • Low expression levels:

    • Test multiple E. coli strains (beyond BL21(DE3)) to identify optimal expression hosts

    • Explore different expression vectors beyond pET-derived systems

    • Optimize induction conditions (IPTG concentration, temperature, induction time)

    • Consider codon optimization of the htpX gene for the expression host

  • Protein solubility issues:

    • Screen various detergents beyond octyl-β-d-glucoside for membrane extraction

    • Test different buffer compositions to enhance protein stability

    • Consider expressing truncated versions of the protein that retain catalytic activity

    • Explore fusion tags beyond His-tags that may enhance solubility

  • Purification challenges:

    • If metal-affinity chromatography yields poor results, consider alternate tag positions (N-terminal vs. C-terminal)

    • For proteins with multiple conformations, implement additional purification steps

    • Use size-exclusion chromatography to separate monomeric from aggregated forms

    • Optimize detergent concentration throughout the purification process

  • Storage and stability:

    • Perform stability tests at different temperatures and buffer conditions

    • Add stabilizing agents like glycerol (5-50%) or trehalose (6%)

    • Aliquot the purified protein immediately after purification to avoid freeze-thaw cycles

    • For long-term storage, test both -20°C and -80°C conditions

By systematically addressing these potential issues using the approaches outlined above, researchers can maximize their chances of successfully working with recombinant HtpX.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.