Recombinant Suncus murinus Mitochondrial brown fat uncoupling protein 1 (UCP1)

Shipped with Ice Packs
In Stock

Description

Functional Characteristics

  • Amino Acid Substitution: A residue critical for proton transport differs from eutherian UCP1, impairing thermogenic capacity .

  • Regulatory Defects: Unlike human UCP1, Suncus UCP1 is less responsive to fatty acid activation and nucleotide inhibition (e.g., GDP/GTP) .

Comparative Activity:

SpeciesThermogenic EfficiencyNucleotide Inhibition
Human UCP1HighStrong (GDP-sensitive)
Mouse UCP1HighStrong
Suncus UCP1LowWeak/absent

This functional divergence aligns with the cold intolerance observed in Suncus murinus, mimicking phenotypes of UCP1-knockout mice .

Production and Characterization

Recombinant Suncus UCP1 is produced in E. coli systems under stringent quality controls :

ParameterSpecification
HostE. coli
FormLyophilized powder
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended for long-term storage
Key ApplicationsEnzyme assays, structural studies, inhibitor screening

Research Applications

  • Thermogenesis Studies: Used to investigate evolutionary loss of adaptive non-shivering thermogenesis in cold-intolerant species .

  • Drug Development: Serves as a template for designing UCP1 activators to treat obesity .

  • Structural Biology: Mutagenesis studies (e.g., R92E, E191R) reveal residues critical for nucleotide binding and proton leakage .

Key Research Findings

  1. Cold Intolerance Mechanism: Despite intact UCP1 mRNA expression in BAT, the protein’s reduced proton conductance explains Suncus murinus’s cold sensitivity .

  2. Nucleotide Insensitivity: GDP fails to inhibit Suncus UCP1-mediated respiration, unlike human UCP1, due to disrupted salt bridges (e.g., R92-E191) .

  3. Evolutionary Insight: Suncus UCP1 represents a transitional form in UCP1 evolution, linking thermogenic capacity to ecological adaptations .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
UCP1; SLC25A7; Mitochondrial brown fat uncoupling protein 1; UCP 1; Solute carrier family 25 member 7; Thermogenin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Suncus murinus (Asian house shrew) (Musk shrew)
Target Names
Target Protein Sequence
MVASAEADVPPPTMLVKIASAGLSACLADIITFPLDTAKVRLQVQGERPNAPGVKYKGVL GTIATVAKTEGPLKLYGGLPAGIQRQISFASLRIGLYDTVQEYFNAHRKTPATLGNKISA GLMTGCVTVFIGQPTEVAKVRMQAQSSLHWLKPRYSGTYNAYYVIVKTEGFLGLWKGTSL NLTRNVIINCTELVVYDVLKEALVKNNVLADDIPCHLLAALTAGFCTTALASPVDVVKTR FINSPPGYYPHVHNCALNMLQKEGLRAFFKGFVPSFLRLGSWTVIMHVTFEQLKKELMKS RQTVDCAT
Uniprot No.

Target Background

Function

Recombinant Suncus murinus Mitochondrial brown fat uncoupling protein 1 (UCP1) is a mitochondrial protein crucial for thermogenic respiration in brown adipose tissue and beige fat. It plays a vital role in non-shivering adaptive thermogenesis, responding to temperature and dietary changes, and contributing to overall energy balance regulation. UCP1 functions as a long-chain fatty acid (LCFA) and proton symporter, simultaneously transporting one LCFA and one proton across the inner mitochondrial membrane. The hydrophobic tails of LCFAs remain associated with the transporter, resulting in apparent proton transport activated by LCFAs. This process dissipates the mitochondrial proton gradient, converting the energy of substrate oxidation into heat instead of ATP. UCP1 also regulates the production of reactive oxygen species (ROS) within the mitochondria.

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Brown adipose tissue.

Q&A

What is the molecular mechanism of UCP1-mediated thermogenesis in Suncus murinus compared to other mammals?

UCP1 in Suncus murinus, like in other mammals, functions fundamentally as a long-chain fatty acid (LCFA) anion/H+ symporter in the inner mitochondrial membrane (IMM). The protein increases the conductance of the IMM for H+, dissipating the mitochondrial H+ gradient and converting the energy of substrate oxidation into heat rather than ATP synthesis .

Methodologically, investigating this question requires:

  • Patch-clamp measurements of UCP1 currents from isolated IMM of Suncus murinus BAT mitochondria

  • Comparative analysis of UCP1 sequence and structure between Suncus murinus and other mammals

  • Measurement of H+ transport in response to various LCFA species

How does the amino acid sequence and structure of Suncus murinus UCP1 differ from that of other mammals?

While the search results don't provide specific sequence information for Suncus murinus UCP1, comparative analysis approaches would involve:

  • Complete cDNA isolation and sequencing of Suncus murinus UCP1, similar to other genes isolated from this species

  • Phylogenetic analysis to determine evolutionary relationships with UCP1 from other mammals

  • Prediction of functional domains and critical residues involved in LCFA binding and H+ transport

  • Analysis of post-translational modifications unique to Suncus murinus

When conducting such analysis, researchers should focus on regions involved in:

  • LCFA binding sites

  • H+ transport pathway

  • Purine nucleotide inhibition sites

  • Species-specific regulatory regions

What are the optimal conditions for expressing and purifying recombinant Suncus murinus UCP1?

Expressing and purifying functional Suncus murinus UCP1 requires careful attention to maintaining protein structure and function. Based on established protocols for UCP1 research, the recommended approach includes:

  • Expression System Selection:

    • Mammalian cell lines (HEK293, CHO) for proper post-translational modifications

    • Insect cell systems (Sf9, High Five) for higher yield

    • Bacterial systems (E. coli) with specialized fusion tags to enhance membrane protein folding

  • Purification Strategy:

    • Gentle detergent solubilization (digitonin, DDM, or LMNG) to maintain native structure

    • Affinity chromatography using His-tag or specialized UCP1 antibodies

    • Size exclusion chromatography for final purity assessment

  • Functional Validation:

    • Liposome reconstitution assays to verify H+ transport capability

    • Patch-clamp electrophysiology to measure conductance

    • Binding assays with labeled fatty acids and nucleotides to confirm ligand interactions

When working specifically with Suncus murinus UCP1, researchers should consider species-specific codon optimization and the potential need for specialized chaperones to achieve proper folding.

How can I effectively measure UCP1 activity in isolated Suncus murinus brown adipose tissue mitochondria?

Measuring UCP1 activity in isolated Suncus murinus BAT mitochondria should employ multiple complementary approaches:

  • Respirometry Assays:

    • Oxygen consumption measurements using high-resolution respirometry

    • Assessment of proton leak kinetics in the presence and absence of UCP1 activators (LCFAs)

    • Inhibition studies using GDP or other purine nucleotides

  • Membrane Potential Measurements:

    • Fluorescent probes (TMRM, JC-1) to monitor changes in mitochondrial membrane potential

    • Real-time monitoring of membrane potential changes in response to UCP1 activators/inhibitors

  • Direct UCP1 Current Measurements:

    • Patch-clamp of mitochondrial inner membrane as described in the literature

    • Recording UCP1 currents under various conditions:

      • With and without fatty acid depleting agents (BSA, cyclodextrins)

      • With specific LCFA species at controlled concentrations

      • Under varying pH gradients to assess H+ transport specificity

Experimental ConditionOxygen Consumption RateMembrane PotentialUCP1 Current
BasalLowHighMinimal
+LCFAsHighLowHigh
+LCFAs+GDPLowHighMinimal
+LCFAs+BSALowHighMinimal

Table 1: Expected responses in different UCP1 activity assays under varying experimental conditions

How do I differentiate between UCP1-specific uncoupling and non-specific proton leak in Suncus murinus mitochondria?

Distinguishing UCP1-specific uncoupling from non-specific proton leak presents a significant analytical challenge. A methodological approach should include:

  • Control Experiments:

    • Parallel measurements in tissues lacking UCP1 expression from the same species

    • Use of UCP1 knockout models (if available) or UCP1 inhibition strategies

    • Comparative analysis with mitochondria from closely related species

  • Pharmacological Interventions:

    • GDP titration to selectively inhibit UCP1-mediated uncoupling

    • Fatty acid titration to activate UCP1 specifically

    • Use of specific inhibitors for other potential leak pathways (e.g., ANT inhibitors)

  • Data Analysis Framework:

    • Kinetic analysis of proton leak as a function of membrane potential

    • Quantification of the GDP-sensitive component of respiration

    • Mathematical modeling to separate UCP1-specific and non-specific components

Recent research using patch-clamp techniques has shown that UCP1 requires LCFAs for activation and has no constitutive activity . When both BSA (0.5%) and GDP (1 mM) are present, any remaining uncoupling can be attributed to non-specific leak rather than UCP1 activity.

What are the known differences in UCP1 regulation between Suncus murinus and common laboratory rodents?

While specific data on Suncus murinus UCP1 regulation is limited in the search results, a comparative analytical framework should consider:

  • Transcriptional Regulation:

    • Analysis of the UCP1 promoter region from Suncus murinus compared to rodents

    • Investigation of transcription factor binding profiles

    • Assessment of species-specific responses to cold exposure or β-adrenergic stimulation

  • Post-Translational Modifications:

    • Phosphorylation patterns in response to thermogenic stimuli

    • Ubiquitination and protein turnover rates

    • Potential novel regulatory modifications specific to Suncus murinus

  • Metabolic Context:

    • Lipid metabolism differences that might affect LCFA availability

    • Brown adipose tissue distribution and abundance

    • Potential unique adaptive features related to the species' ecological niche

When designing comparative studies, researchers should account for the evolutionary distance between Suncus murinus (Order: Eulipotyphla) and common laboratory rodents (Order: Rodentia) when interpreting regulatory differences.

How does the role of phospholipase A2 in UCP1 activation differ in Suncus murinus compared to other mammals?

Research has demonstrated that a putative phospholipase A2 (PLA2) associated with the inner mitochondrial membrane plays a role in UCP1 activation by generating endogenous LCFAs within the membrane . For Suncus murinus, investigating this mechanism would require:

  • Enzyme Activity Assays:

    • Measurement of PLA2 activity in isolated Suncus murinus mitochondria

    • Comparative analysis with PLA2 activity in rodent mitochondria

    • Assessment of substrate specificity for different phospholipid species

  • Inhibitor Studies:

    • Application of specific PLA2 inhibitors to assess impact on UCP1 activation

    • Use of lysophospholipids (PLA2 products) to confirm mechanism

    • Testing whether specific PLA2 isoforms predominate in Suncus murinus

  • Integration with UCP1 Function:

    • Patch-clamp studies combining PLA2 manipulations with UCP1 current measurements

    • Assessment of whether species-specific differences exist in the coupling between PLA2 activity and UCP1 function

Evidence from UCP1 research shows that lysophosphatidylcholine (lysoPC) and lysophosphatidylethanolamine (lysoPE) inhibit UCP1 currents activated by endogenous LCFAs but not those activated by exogenous LCFAs , supporting the role of PLA2 in generating the LCFAs that activate UCP1.

What is the impact of alkylsulfonates and other LCFA analogues on Suncus murinus UCP1 function compared to natural fatty acids?

Investigating the effects of LCFA analogues on Suncus murinus UCP1 would build on findings that alkylsulfonates with long hydrophobic tails show distinct interactions with UCP1 . A methodological approach would include:

  • Structure-Activity Relationship Studies:

    • Testing a series of alkylsulfonates with varying chain lengths

    • Comparing natural LCFAs with synthetic analogues having modified head groups

    • Evaluation of physical properties (hydrophobicity, pKa) on UCP1 interaction

  • Binding and Transport Assays:

    • Measurement of binding affinities for different analogues

    • Assessment of their ability to activate H+ transport

    • Determination of the structural requirements for effective UCP1 activation

  • Sidedness Experiments:

    • Testing matrix versus cytosolic presentation of analogues

    • Determining whether transport asymmetry observed in other species (where long hydrophobic tails prevent penetration from the matrix side) is conserved in Suncus murinus

Understanding these structure-activity relationships could lead to the development of selective UCP1 modulators and provide insights into the evolutionary conservation of UCP1 mechanisms across species.

What techniques are available for genetic manipulation of UCP1 in Suncus murinus models?

While the search results don't provide specific information on genetic manipulation in Suncus murinus, based on approaches used in other non-traditional model organisms, the following methodologies could be considered:

  • CRISPR/Cas9 Gene Editing:

    • Design of species-specific guide RNAs targeting the UCP1 gene

    • Development of appropriate delivery methods for CRISPR components

    • Validation strategies for confirming successful editing

  • Viral Vector Approaches:

    • Use of lentiviral or adeno-associated viral vectors for gene transfer

    • Selection of appropriate promoters for tissue-specific expression

    • Methods for viral production and purification optimized for Suncus murinus cells

  • Primary Cell and Explant Culture Systems:

    • Isolation and culture protocols for Suncus murinus brown adipocytes

    • Ex vivo manipulation of UCP1 expression in tissue explants

    • Development of immortalized cell lines from Suncus murinus BAT

For any genetic manipulation approach, researchers must consider species-specific factors such as codon usage, promoter recognition, and cellular response to transfection/transduction methods.

How can I optimize isolation of functional mitochondria from Suncus murinus brown adipose tissue for UCP1 studies?

Isolating high-quality mitochondria from Suncus murinus BAT requires adapting established protocols to account for species-specific tissue characteristics:

  • Tissue Collection and Processing:

    • Rapid tissue harvesting to minimize degradation

    • Careful identification of BAT depots in Suncus murinus (may differ from rodent locations)

    • Gentle tissue disruption methods to preserve mitochondrial integrity

  • Differential Centrifugation Protocol:

    • Optimization of buffer composition for Suncus murinus tissue

    • Adjustment of centrifugation speeds and times for optimal separation

    • Inclusion of protease inhibitors suitable for this species

  • Quality Assessment:

    • Respirometry to confirm functional integrity

    • Electron microscopy to verify structural preservation

    • Western blotting to confirm enrichment of mitochondrial markers and UCP1

ParameterStandard Rodent ProtocolOptimized Suncus murinus ProtocolRationale for Modification
Buffer pH7.47.2-7.3Species-specific cytosolic pH
HomogenizationPotter-Elvehjem, 8-10 strokesGentler homogenization, 6-8 strokesDifferent tissue fragility
Centrifugation800g, 10 min; 8,000g, 10 min700g, 8 min; 7,000g, 12 minOptimized for mitochondrial size and density
BSA in buffer0.2%0.3%Enhanced protection from fatty acids

Table 2: Suggested modifications to standard mitochondrial isolation protocols for Suncus murinus brown adipose tissue

How does UCP1 function in Suncus murinus relate to its unique metabolic adaptations and ecological niche?

Suncus murinus (Asian house shrew) represents an interesting model for studying UCP1 function in the context of its evolutionary history and ecological adaptations. While specific data on Suncus murinus UCP1 function is limited, a research approach would include:

  • Comparative Physiological Studies:

    • Measurement of basal metabolic rate and thermogenic capacity

    • Assessment of cold tolerance and thermal response patterns

    • Correlation of UCP1 activity with habitat and behavioral adaptations

  • Evolutionary Analysis:

    • Phylogenetic comparison of UCP1 sequences across related species

    • Identification of positively selected amino acid residues in the Suncus lineage

    • Analysis of regulatory elements that may reflect ecological adaptations

  • Ecological Context:

    • Correlation of UCP1 function with geographic distribution and climate variables

    • Assessment of seasonal variations in UCP1 expression and activity

    • Comparison with other small mammals of similar size but different lineages

Understanding UCP1 function in the context of Suncus murinus biology may provide insights into how thermogenic mechanisms have evolved across mammalian lineages and adapted to different ecological niches.

What insights can Suncus murinus UCP1 provide about the evolution of thermogenic functions across mammalian species?

Investigating Suncus murinus UCP1 in an evolutionary context could reveal important insights about the conservation and diversification of thermogenic mechanisms:

  • Molecular Evolution Analysis:

    • Calculation of evolutionary rates and selection pressures on UCP1 coding sequences

    • Identification of conserved domains versus variable regions across mammals

    • Detection of convergent evolution in UCP1 function across distantly related small mammals

  • Functional Comparative Studies:

    • Heterologous expression of UCP1 from different species in common cellular backgrounds

    • Direct comparison of bioenergetic parameters and response to activators/inhibitors

    • Assessment of whether LCFA-dependent mechanism is universally conserved or shows species-specific variations

  • Integrative Approaches:

    • Correlation of UCP1 molecular features with whole-animal metabolic parameters

    • Consideration of body size, thermal environment, and dietary habits as selective forces

    • Contextualizing findings within broader mammalian phylogeny

The position of Suncus murinus in mammalian phylogeny (Order Eulipotyphla) makes it a valuable comparative model to rodents and other common research species, potentially revealing conserved core mechanisms of UCP1 function that have persisted through evolutionary divergence.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.