Recombinant Sundamys muelleri Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you require a specific format, please specify this in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping is available upon request and will incur additional charges. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its inclusion.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Sundamys muelleri (Mueller's giant sunda rat)
Target Names
Target Protein Sequence
MAYPFQLGLQDATSPIMEELTNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTNTMDAQE VETIWTILPAVILILIALPSLRILYMMDEINNPALTVKTMGHQWYWSYEYTDYEDLCFDS YMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLN QATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKHFENWSASMI
Uniprot No.

Target Background

Function

Recombinant Sundamys muelleri Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the CuA center of subunit 2 and heme A of subunit 1 to the active site (a binuclear center comprising heme A3 and CuB) in subunit 1. This binuclear center utilizes four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Sundamys muelleri Cytochrome c oxidase subunit 2 and its biological significance?

Cytochrome c oxidase subunit 2 (MT-CO2) is a mitochondrially-encoded component of cytochrome c oxidase (COX), which functions as the terminal enzyme of the mitochondrial respiratory chain. This enzyme catalyzes the transfer of electrons from reduced cytochrome c to molecular oxygen . In Sundamys muelleri, MT-CO2 consists of 227 amino acids and plays a crucial role in cellular respiration.

The protein is particularly significant in comparative studies of mitochondrial function across rodent species. Sundamys muelleri, commonly known as Mueller's Rat, is distributed across Southwest peninsular Myanmar, peninsular Thailand, Malay Peninsula, Sumatra, Borneo, Palawan Island, and numerous offshore islands . The recombinant form allows researchers to study this protein outside its native context for various experimental applications.

How is the recombinant form of Sundamys muelleri MT-CO2 produced?

The recombinant full-length Sundamys muelleri MT-CO2 protein is expressed in E. coli expression systems with an N-terminal histidine tag (His-tag) for purification purposes. The protein corresponds to the UniProt entry Q38RU7. After expression, the protein is typically purified using affinity chromatography that targets the His-tag, followed by additional purification steps to achieve >90% purity as determined by SDS-PAGE .

The expression in a bacterial system allows for scalable production but requires careful refolding considerations since the native protein exists in a membrane environment within mitochondria.

What is the role of MT-CO2 in cytochrome c oxidase assembly and function?

Research on cytochrome c oxidase has revealed that its assembly requires both nuclear- and mitochondrial-encoded subunits along with numerous nuclear gene products that assist at different maturation stages. Studies in Saccharomyces cerevisiae have shown that cytochrome c plays a critical structural role rather than a functional role in the assembly of cytochrome c oxidase .

For MT-CO2 specifically, this subunit forms part of the catalytic core of the enzyme and contains copper centers involved in electron transfer. The protein spans the inner mitochondrial membrane and contributes to proton pumping during respiration. Understanding the structural role of MT-CO2 in cytochrome c oxidase assembly can provide insights into mitochondrial disorders associated with cytochrome c oxidase deficiency .

How does the His-tag modification affect the structure and function of recombinant MT-CO2?

AspectPotential Effect of His-tagResearch Consideration
Protein FoldingMay influence tertiary structureVerify proper folding via circular dichroism
Enzymatic ActivityPossible reduction in activityCompare with tag-cleaved version when assessing function
OligomerizationCould affect protein-protein interactionsAnalyze oligomeric state by size exclusion chromatography
CrystallizationMay facilitate or hinder crystal formationTest both tagged and untagged versions for structural studies
Antibody RecognitionPotential epitope maskingUse antibodies targeting different regions of the protein

For studies requiring native-like function, researchers may consider removing the His-tag using appropriate proteases after purification .

What structural differences exist between Sundamys muelleri MT-CO2 and human MT-CO2?

Comparing the Sundamys muelleri MT-CO2 with human MT-CO2 reveals several key structural differences that are important for comparative and evolutionary studies:

  • Sequence conservation in the catalytic domains but variations in peripheral regions

  • Species-specific post-translational modification sites

  • Differences in membrane-spanning domains that may affect lipid interactions

  • Variations in copper-binding motifs that could influence catalytic efficiency

These structural differences make Sundamys muelleri MT-CO2 valuable for evolutionary studies and potentially for understanding species-specific adaptations in the respiratory chain. Researchers studying cytochrome c oxidase deficiency may use these comparative insights to better understand the human condition .

What are the optimal storage and reconstitution conditions for recombinant MT-CO2?

Proper storage and reconstitution are crucial for maintaining the stability and activity of recombinant Sundamys muelleri MT-CO2:

Storage Conditions:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution Protocol:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended 50%)

  • Aliquot for long-term storage at -20°C/-80°C

Storage Buffer:
The protein is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain stability during storage .

What experimental controls should be included when studying recombinant MT-CO2?

When designing experiments with recombinant Sundamys muelleri MT-CO2, include the following controls:

Control TypePurposeImplementation
Negative ControlEstablish baseline and rule out non-specific effectsBuffer-only or irrelevant protein of similar size
Positive ControlValidate assay functionalityWell-characterized cytochrome c oxidase subunit from another species
His-tag ControlAssess tag interferenceHis-tagged non-related protein
Activity ControlVerify functional integrityCytochrome c oxidase activity assay with known substrates
Denatured Protein ControlDistinguish structure-dependent effectsHeat-denatured MT-CO2
Species ComparisonEvaluate evolutionary conservationParallel experiments with human or mouse MT-CO2

These controls help ensure experimental rigor and facilitate accurate interpretation of results across different experimental conditions.

What techniques are most effective for studying MT-CO2 protein-protein interactions?

Studying the protein-protein interactions of Sundamys muelleri MT-CO2 is crucial for understanding its role in the respiratory chain complex. Several techniques are particularly effective:

  • Co-immunoprecipitation (Co-IP): Using anti-His antibodies to pull down MT-CO2 and identify interacting partners by mass spectrometry.

  • Biolayer Interferometry (BLI) or Surface Plasmon Resonance (SPR): For quantitative binding kinetics between MT-CO2 and potential partners, particularly cytochrome c.

  • Proximity Labeling: Techniques like BioID or APEX2 can identify proximal proteins in a more native environment.

  • Yeast Two-Hybrid Assays: Can be adapted for membrane proteins to screen for interacting partners.

  • Crosslinking Mass Spectrometry: To capture transient interactions within the respiratory complex.

Research has shown that cytochrome c plays a structural rather than functional role in cytochrome c oxidase assembly , suggesting that studying these interactions may provide insights into both assembly and function of the complete enzyme complex.

What regulatory requirements apply to research using recombinant Sundamys muelleri MT-CO2?

Research involving recombinant Sundamys muelleri MT-CO2 falls under regulations for recombinant or synthetic nucleic acid (r/sNA) molecules research. Key considerations include:

  • Registration Requirements: Principal Investigators must register all r/sNA research materials whether created, purchased, or obtained from colleagues .

  • Institutional Approval: Work must be approved by the Biological Safety Committee before initiation .

  • Containment Level: Since the recombinant protein is expressed in E. coli, work typically requires Biosafety Level 2 (BSL2) containment .

  • Documentation: Maintain records of all experimental procedures, risk assessments, and safety protocols.

  • Training: Ensure all research personnel receive appropriate biosafety training.

The research does not fall under Section III-C-1 of NIH Guidelines as it does not involve deliberate transfer of recombinant materials into human research participants .

How should researchers handle and dispose of recombinant MT-CO2 materials?

Proper handling and disposal of recombinant Sundamys muelleri MT-CO2 materials ensure research safety and regulatory compliance:

Handling Guidelines:

  • Use appropriate personal protective equipment (PPE) including lab coat, gloves, and eye protection

  • Work in designated areas for recombinant protein research

  • Use aerosol-resistant tips for pipetting

  • Avoid generating aerosols or splashes

  • Note that the product is labeled "Not For Human Consumption"

Disposal Protocols:

  • Decontaminate all materials that contact the recombinant protein using an appropriate disinfectant

  • Dispose of liquid waste in dedicated containers treated with disinfectant before final disposal

  • Collect solid waste in biohazard bags for autoclaving

  • Follow institutional guidelines for biohazardous waste disposal

  • Document all disposal procedures as required by institutional policies

Following these guidelines helps maintain research integrity while complying with institutional and regulatory requirements for recombinant materials.

How can recombinant MT-CO2 be used to study mitochondrial disorders?

Recombinant Sundamys muelleri MT-CO2 provides a valuable tool for studying mitochondrial disorders, particularly cytochrome c oxidase deficiency:

  • Comparative Functional Analysis: Comparing wild-type and mutant versions of MT-CO2 can help understand how specific mutations affect enzyme function.

  • Structure-Function Relationships: The recombinant protein enables structure-function studies to identify critical domains and residues involved in cytochrome c oxidase activity.

  • Interaction Studies: Investigating how MT-CO2 interacts with other subunits helps understand assembly defects in mitochondrial disorders.

  • Therapeutic Screening: The protein can serve as a target for screening potential therapeutic compounds that might restore function in deficient states.

  • Biomarker Development: Antibodies against conserved regions of MT-CO2 could be developed for diagnostic applications.

Cytochrome c oxidase deficiency is a genetic condition that can affect skeletal muscles, the heart, the brain, or the liver, caused by mutations in more than 20 genes . Using the recombinant protein allows researchers to isolate specific effects of MT-CO2 dysfunction from whole-organism complications.

What evolutionary insights can be gained from studying Sundamys muelleri MT-CO2?

Sundamys muelleri MT-CO2 serves as an excellent model for evolutionary studies due to the species' distinct phylogenetic position:

  • Phylogenetic Analysis: MT-CO2 sequences can be used to refine phylogenetic relationships within rodents, particularly the Muridae family. Sundamys muelleri is known to be a sister species to S. maxi based on recent phylogenetic analysis .

  • Selection Pressure Mapping: Comparing conservation patterns across species helps identify regions under different selection pressures, revealing functionally critical domains.

  • Adaptive Evolution: The species' distribution across diverse habitats in Southeast Asia (from Myanmar to Borneo and Palawan Island) makes it valuable for studying adaptive evolution of mitochondrial proteins.

  • Coevolution Analysis: Studying how MT-CO2 has coevolved with nuclear-encoded subunits provides insights into mitonuclear compatibility.

  • Molecular Clock Applications: MT-CO2 can be used in molecular clock analyses to estimate divergence times among rodent lineages.

These evolutionary studies contribute to our understanding of mitochondrial genome evolution and the adaptability of the respiratory chain across different mammalian lineages.

What are the technical challenges in expressing and purifying functional MT-CO2?

Researchers face several technical challenges when working with recombinant Sundamys muelleri MT-CO2:

ChallengeTechnical DetailsPotential Solutions
Membrane Protein ExpressionMT-CO2 is naturally membrane-boundUse specialized E. coli strains; consider membrane-mimetic systems
Proper FoldingMay misfold in bacterial systemsInclude molecular chaperones; optimize induction conditions
Maintaining Copper CentersCopper binding is essential for functionSupplement growth media with copper; use anaerobic purification
Solubility IssuesHydrophobic regions cause aggregationUse appropriate detergents; consider fusion partners to increase solubility
Post-translational ModificationsBacterial systems lack mitochondrial modificationsConsider eukaryotic expression systems for certain applications
Functional ReconstitutionIsolated subunit may lack activityReconstitute with other subunits to form functional complex

These challenges highlight why the commercially available recombinant protein is provided as a lyophilized powder with specific reconstitution guidelines . Researchers should consider these limitations when designing experiments and interpreting results.

How can researchers address protein degradation issues with recombinant MT-CO2?

Protein degradation is a common challenge when working with recombinant Sundamys muelleri MT-CO2. To address this issue:

  • Storage Optimization:

    • Maintain storage at -20°C/-80°C as recommended

    • Avoid repeated freeze-thaw cycles by preparing smaller working aliquots

    • Consider adding additional protease inhibitors to storage buffer

  • Handling Procedures:

    • Keep samples on ice during experiments

    • Use pre-chilled buffers and equipment

    • Process samples quickly to minimize exposure time at higher temperatures

  • Buffer Optimization:

    • The recommended Tris/PBS-based buffer with 6% Trehalose at pH 8.0 helps maintain stability

    • Consider testing alternative buffer systems with different pH values or stabilizing agents

    • The addition of glycerol (5-50%) can further enhance stability

  • Detection Methods:

    • Use freshly prepared samples for critical experiments

    • Include molecular weight markers when running gels to identify degradation products

    • Consider Western blotting with antibodies targeting different regions to identify specific degradation patterns

These approaches can significantly reduce degradation issues and improve experimental reproducibility.

What methods are recommended for assessing the functional activity of recombinant MT-CO2?

Assessing the functional activity of recombinant Sundamys muelleri MT-CO2 requires specialized approaches since the isolated subunit is part of a larger complex:

  • Reconstitution Assays:

    • Combine with other purified cytochrome c oxidase subunits to reconstitute the functional complex

    • Assess assembly efficiency using blue native PAGE

    • Compare activity with reconstituted complexes from other species

  • Electron Transfer Measurements:

    • Measure electron transfer from reduced cytochrome c to oxygen

    • Use oxygen consumption assays with polarographic electrodes

    • Employ spectrophotometric techniques to monitor cytochrome c oxidation at 550 nm

  • Binding Studies:

    • Assess interaction with cytochrome c using surface plasmon resonance

    • Determine binding constants and compare with native enzyme

    • Investigate the structural role in complex assembly as indicated by previous research

  • Copper Center Analysis:

    • Quantify copper content using atomic absorption spectroscopy

    • Assess the integrity of copper centers using electron paramagnetic resonance (EPR)

    • Correlate copper content with functional activity

Research has shown that cytochrome c plays a structural rather than functional role in assembly of cytochrome c oxidase , suggesting that structural assessment may be as important as functional assays.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.