Recombinant SURF1-like protein (sft-1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, provided as a guideline for customer use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
sft-1; H06I04.2; SURF1-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-323
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
sft-1
Target Protein Sequence
MPLPAAAFARILVVSRQRLFNTRIIHTSGSGYSITQCRFYKTTPCLTHKQSQILDLDAPK SRENREKDGGKSKKSKKSIKWSTGSVLMLTIPVFAFSLGIWQTFRLKWKLDLIEHLKGRL NQTAQELPEDLSCESLEPLEYCRVTVTGEFLHEKEFIISPRGRFDPGKKTSAAAGSMLSE NEMSSHGGHLITPFRLKNSGKIILINRGWLPSFYFDPETRQKTNPRGTLTLPAIVRKTEK RPQFVGQNVPEQGVWYYRDLNQMAKHYGTEPVLLDAAYETTVPGGPIGGQTNINVRNEHL NYLTTWFTLTLVTMLMWIHKFRK
Uniprot No.

Target Background

Function
Likely involved in the biogenesis of the COX complex.
Database Links

KEGG: cel:CELE_H06I04.2

STRING: 6239.H06I04.2

UniGene: Cel.10362

Protein Families
SURF1 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the relationship between SURF1-like protein (sft-1) and human SURF1?

SURF1-like protein (sft-1) shares functional homology with human SURF1, which is essential for cytochrome c oxidase (Complex IV) assembly in the mitochondrial respiratory chain. Human SURF1 aids in the correct assembly of Complex IV, a critical enzyme in oxidative phosphorylation that converts energy from food into a form cells can use. SURF1 protein facilitates the assembly of this complex, which accepts electrons from earlier steps in oxidative phosphorylation and performs the chemical reaction converting oxygen to water while generating energy for ATP production .

What structural characteristics define functional sft-1 proteins?

Based on human SURF1 structure, functional sft-1 is likely a hydrophobic 30-kDa polypeptide with two transmembrane domains at the N and C termini that anchor the protein to the mitochondrial inner membrane. These structural elements are crucial for proper positioning within the mitochondrial membrane to facilitate Complex IV assembly . Research approaches using site-directed mutagenesis of these domains can help determine their specific roles in protein localization and function.

How can researchers distinguish between proper and improper folding of recombinant sft-1?

Methodology: Researchers should employ multiple complementary techniques:

  • Circular dichroism spectroscopy to assess secondary structure composition

  • Limited proteolysis followed by mass spectrometry to identify exposed regions

  • Thermal shift assays to determine protein stability

  • Size-exclusion chromatography to detect aggregate formation

  • Functional assays measuring Complex IV assembly capacity as the definitive test of properly folded protein

What are the optimal methodologies for studying sft-1 interactions with mitochondrial assembly factors?

When designing interaction studies, researchers should consider a multi-faceted approach:

  • Co-immunoprecipitation with antibodies against native Complex IV components

  • Blue Native Gel Electrophoresis (BNGE) to preserve protein complexes during analysis

  • Proximity labeling methods such as BioID or APEX2 to identify transient interactions

  • Crosslinking mass spectrometry to map interaction interfaces

For quantitative assessment of Complex IV assembly, researchers should measure both fully assembled complex and subassembly intermediates using antibodies against multiple subunits (e.g., MTCO1 and COX4) .

How should researchers design knockout/knockdown models to study sft-1 function?

Based on SURF1 knockout studies in mice, researchers should consider:

  • Complete gene knockout may show only ~50% reduction in Complex IV activity, suggesting compensatory mechanisms

  • Tissue-specific conditional knockouts to avoid developmental effects

  • Assessment of multiple phenotypic parameters:

    • Complex IV activity in multiple tissues (brain, muscle, liver)

    • MT-CO1 protein expression levels

    • Exercise-induced blood lactic acidosis

    • Neurological function in models of Leigh syndrome

What stratification strategies optimize experimental design for sft-1 research?

When designing experiments with limited sample sizes:

  • Utilize historical data for k-group stratification to reduce required sample size by up to 20%

  • Implement non-linear staggered designs with stratification for sequential experiments

  • Consider precision-guided adaptive experimentation approaches for studies requiring sequential decision-making

  • Apply sample-splitting techniques from machine learning to ensure valid statistical inference

This approach can significantly reduce experimental costs while maintaining statistical power.

What methodological approaches best characterize the impact of sft-1 mutations?

For comprehensive mutation analysis:

  • Expression of wild-type and mutant sft-1 in SURF1-deficient cells

  • Assessment of protein stability through cycloheximide chase experiments

  • Subcellular localization studies using immunofluorescence microscopy

  • Analysis of mutant protein incorporation into assembly intermediates

  • Quantification of rescue effect on Complex IV activity and content

In SURF1-deficient patient cells, most mutations result in either abnormally short proteins or single amino acid substitutions that lead to protein degradation and absence of functional SURF1 protein .

How can researchers quantitatively assess Complex IV assembly in sft-1 research?

Methodology:

  • One-dimensional Blue Native Gel Electrophoresis (BNGE) using antibodies against multiple subunits:

    • MTCO1 (mitochondrially-encoded)

    • COX4 (nuclear-encoded)

  • Quantification relative to control samples (typically 18% of control with MTCO1 and 8% with COX4 antibodies in SURF1-deficient cells)

  • Assessment for presence of subassembly species that may indicate partial assembly

What biochemical assays effectively measure sft-1 function in experimental models?

Key functional assays should include:

  • Complex IV enzymatic activity measurements in multiple tissues

  • Western blot analysis of MT-CO1 protein expression levels

  • Blood lactate measurements following standardized exercise protocols

  • Oxygen consumption rate in isolated mitochondria or intact cells

  • ATP production capacity under various substrate conditions

In SURF1-deficient mice, these assays revealed approximately 50% reduced Complex IV activity and reduced MT-CO1 protein expression across multiple organs compared to wild-type mice .

What vector design considerations are critical for sft-1/SURF1 gene replacement therapy?

Research methodology for effective gene therapy:

  • Select appropriate delivery vector (AAV9 shows efficacy for CNS delivery)

  • Optimize gene sequence (codon optimization improves expression)

  • Choose effective administration route (intrathecal administration targets CNS)

  • Determine minimal effective dose through dose-escalation studies

  • Assess biodistribution across target tissues

Preclinical studies with AAV9/hSURF1 have demonstrated that a single intrathecal administration can partially rescue Complex IV activity in multiple tissues including liver, brain, and muscle .

How should researchers evaluate efficacy of sft-1-directed gene therapies?

Comprehensive efficacy assessment should include:

  • Biochemical markers:

    • Complex IV activity in target tissues

    • MT-CO1 protein expression levels

    • Mitochondrial oxygen consumption rate

  • Physiological responses:

    • Exercise-induced blood lactate levels

    • Neurological function assessments

  • Long-term outcomes:

    • Sustained protein expression (9+ months post-dosing)

    • Safety profile through histopathological examination

Studies in SURF1 knockout mice have shown that AAV9/hSURF1 therapy can mitigate blood lactic acidosis induced by exhaustive exercise at 9 months post-dosing, demonstrating long-term therapeutic potential .

What safety parameters should be monitored in sft-1 gene therapy research?

Critical safety assessment includes:

  • In-life observations for adverse events

  • Comprehensive histopathological examination of major tissues

  • Immune responses to both vector and transgene product

  • Off-target expression analysis

  • Long-term follow-up (minimum 12 months)

Toxicity studies in wild-type mice receiving intrathecal AAV9/hSURF1 showed no adverse effects in either in-life observations or microscopic examination of major tissues up to a year following treatment .

How does sft-1 research inform understanding of Leigh syndrome pathophysiology?

Leigh syndrome is an early-onset neurodegenerative disorder characterized by reduction in Complex IV activity and disrupted mitochondrial function. Approximately 10-15% of Leigh syndrome patients have mutations in the SURF1 gene, making it a significant genetic cause of this condition . Research on sft-1 provides insights into:

  • Mechanisms of Complex IV assembly disruption

  • Tissue-specific consequences of SURF1 deficiency

  • Potential therapeutic targets for intervention

  • Biomarkers for disease progression and treatment response

What are the optimal disease models for studying sft-1-related disorders?

Researchers should consider multiple model systems:

  • Patient-derived fibroblasts:

    • Allow direct study of human mutations

    • Enable assessment of mitochondrial function

    • Limited by tissue-specific differences

  • SURF1 knockout mice:

    • Display biochemical abnormalities (reduced Complex IV activity)

    • Show exercise-induced lactic acidosis

    • May not fully recapitulate the neurological phenotype

  • iPSC-derived neurons:

    • Enable study in relevant cell types

    • Allow isogenic controls through gene editing

    • Support high-throughput screening

Each model system offers distinct advantages for addressing specific research questions .

How does SURF1/sft-1 deficiency contribute to Charcot-Marie-Tooth disease?

SURF1 deficiency has been identified as a cause of demyelinating autosomal recessive Charcot-Marie-Tooth disease (CMT4). Research methodologies to study this connection include:

  • Genetic screening of CMT4 patients for SURF1 mutations after exclusion of known CMT4 genes

  • RT-PCR analysis to identify aberrant splicing products

  • Protein analysis using both monoclonal and polyclonal antibodies

  • Assessment of Complex IV assembly status using BNGE

Studies have identified specific mutations (e.g., homozygous splice site mutation c.107-2A>G) that affect SURF1 splicing and result in virtually absent SURF1 protein in patients with CMT4 .

What methods can reveal the molecular mechanisms of sft-1-mediated Complex IV assembly?

Advanced methodological approaches include:

  • Cryo-electron microscopy to visualize assembly intermediates

  • Time-resolved proteomics to track assembly sequence

  • In vitro reconstitution of assembly steps with purified components

  • Structure-function analysis through systematic mutagenesis

  • Comparative studies across species to identify evolutionarily conserved mechanisms

How can multi-omics approaches enhance sft-1 research?

Integrated multi-omics strategies should include:

  • Proteomics to identify changes in mitochondrial protein composition

  • Transcriptomics to detect compensatory responses

  • Metabolomics to characterize changes in metabolic pathways

  • Lipidomics to assess mitochondrial membrane composition

  • Systems biology approaches to integrate these datasets

This multi-dimensional analysis can reveal unexpected consequences of sft-1 deficiency beyond direct effects on Complex IV.

What novel therapeutic strategies beyond gene replacement might target sft-1-related disorders?

Researchers should explore:

  • Small molecule chaperones to stabilize mutant SURF1 proteins

  • Metabolic bypass strategies to compensate for Complex IV deficiency

  • Mitochondrial biogenesis inducers to increase functional mitochondria

  • Antioxidant approaches targeting secondary oxidative stress

  • mRNA therapy for transient expression in affected tissues

Each approach requires specific methodological considerations for preclinical testing and potential translation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.