Recombinant Swinepox virus E3 ubiquitin-protein ligase LAP (LAP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LAP; C7L; E3 ubiquitin-protein ligase LAP; Leukemia associated protein; LAP; RING-type E3 ubiquitin transferase LAP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Swinepox virus (strain Kasza) (SWPV)
Target Names
LAP
Target Protein Sequence
MDPVCWICKDDYSIEKNYCNCKNEYKVVHDECMKKWIQYSRERSCKLCNKEYNIISVRKP FSQWVFSIKDCKKSAILYATLFLCTFIISLVLTRINITKIIDTSKNDVSFKLVTMIFYLL PFVITCISFITLIVYLYKYCKISAKNNTYDTIYEL
Uniprot No.

Target Background

Function

E3 ubiquitin-protein ligase that promotes ubiquitination and subsequent degradation of host MHC-I and CD4 molecules. This mechanism likely prevents lysis of infected cells by cytotoxic T lymphocytes and NK cells. The protein binds target molecules through transmembrane interactions. Ubiquitination enhances endocytosis of the target molecule, leading to lysosomal delivery and proteolytic destruction.

Protein Families
Poxviridae LAP protein family
Subcellular Location
Host membrane; Multi-pass membrane protein. Host Golgi apparatus, host trans-Golgi network membrane. Host early endosome membrane.

Q&A

What is Swinepox virus E3 ubiquitin-protein ligase LAP and what is its role in viral infection?

Swinepox virus (SWPV) E3 ubiquitin-protein ligase LAP (Leukemia Associated Protein) is a viral enzyme encoded by the LAP gene (also known as C7L) that catalyzes the transfer of ubiquitin to target proteins, marking them for various cellular fates including degradation. The enzyme is classified with the EC number 6.3.2.- and consists of 155 amino acids with a molecular structure containing RING-like zinc finger domains characteristic of many E3 ligases .

LAP likely functions as an immune evasion factor by targeting host immune system components for degradation or modification. Poxviruses have evolved multiple E3 ubiquitin ligases that specifically target innate immune signaling pathways, allowing the virus to replicate effectively despite host antiviral responses . While the specific substrates of LAP have not been fully characterized, based on other poxvirus E3 ligases, it likely targets components of interferon pathways or inflammatory signaling cascades.

How does the recombinant form of Swinepox virus E3 ubiquitin-protein ligase LAP differ from the native protein?

The recombinant form of Swinepox virus E3 ubiquitin-protein ligase LAP is produced through heterologous expression systems, typically using bacterial, insect, or mammalian cell expression platforms. The key differences include:

  • Tag additions: Recombinant LAP typically contains fusion tags (His, GST, FLAG, etc.) that facilitate purification and detection. These tags may be attached to either the N- or C-terminus depending on the experimental requirements .

  • Expression region: The recombinant protein is often expressed as the full-length protein (1-155 amino acids) but can also be produced as specific domains for structural or functional studies .

  • Post-translational modifications: Recombinant LAP produced in bacterial systems may lack post-translational modifications that might be present in the native viral protein during infection.

  • Storage requirements: Recombinant LAP is typically stored in optimized buffer conditions (50% glycerol, Tris-based buffer) at -20°C, with recommendations against repeated freeze-thaw cycles .

  • Folding and activity: Depending on the expression system used, recombinant LAP may have variations in folding and enzymatic activity compared to the native protein expressed during viral infection.

What are the recommended storage conditions for recombinant Swinepox virus E3 ubiquitin-protein ligase LAP?

For optimal stability and activity of recombinant Swinepox virus E3 ubiquitin-protein ligase LAP, the following storage conditions are recommended:

  • Short-term storage: Working aliquots can be stored at 4°C for up to one week .

  • Medium to long-term storage: Store at -20°C in Tris-based buffer containing 50% glycerol, which has been optimized for this protein .

  • Extended storage: For preservation beyond several months, storage at -80°C is recommended .

To maintain protein integrity:

  • Avoid repeated freeze-thaw cycles as they can lead to protein denaturation and loss of enzymatic activity.

  • Store the protein in small working aliquots to minimize freeze-thaw cycles.

  • When thawing, allow the protein to reach room temperature gradually.

  • Glycerol in the storage buffer helps prevent ice crystal formation during freezing and maintains protein stability.

  • Always verify protein activity after extended storage through appropriate enzymatic assays.

How does Swinepox virus E3 ubiquitin-protein ligase LAP compare structurally and functionally with other poxvirus E3 ubiquitin ligases?

Swinepox virus E3 ubiquitin-protein ligase LAP belongs to a diverse family of poxvirus E3 ligases that can be categorized into five main groups based on their structural features and ubiquitin transfer mechanisms:

CategoryStructural FeaturesExamplesFunction in Immune Evasion
PRANCPox protein repeats of ankyrin C-terminal domainCowpox CP77, Vaccinia K1LInhibits NF-κB activation
ANK/BCAnkyrin repeat/Elongin B/Elongin CECTV 010, ECTV 024, CPXV 006Targets RIPK3
BBKBTB/KelchECTV EVM150, EVM167, SPPV-019Regulates cell adhesion
P28/RINGKilA-N domain + RING domainECTV P28, FWPV150, FWPV157Catalyzes K63 ubiquitination
MARCHMembrane-Associated RING-CHCPXV 008MHC-I downregulation

LAP appears most structurally similar to the P28/RING class of poxviral E3 ligases based on its RING domain structure and size, though it has some unique features . The LAP protein contains a distinct RING finger motif that mediates the interaction with E2 ubiquitin-conjugating enzymes and facilitates the transfer of ubiquitin to target substrates.

Unlike some larger poxviral E3 ligases (150-500 amino acids), LAP is relatively small (155 amino acids), suggesting a more specialized function. While P28 proteins from other poxviruses (like Ectromelia virus) have been shown to interact with E2 enzymes Ubc4 and UbcH5c, the specific E2 partners of LAP remain to be fully characterized .

The functional uniqueness of LAP likely reflects the host specificity of Swinepox virus, which infects only swine, suggesting that LAP may have evolved to target specific components of the porcine immune system .

What experimental approaches are most effective for studying the enzymatic activity of recombinant Swinepox virus E3 ubiquitin-protein ligase LAP?

To effectively study the enzymatic activity of recombinant Swinepox virus E3 ubiquitin-protein ligase LAP, researchers should consider the following complementary experimental approaches:

In vitro ubiquitination assays:

  • Reconstitute the ubiquitination cascade using purified components: E1 activating enzyme, appropriate E2 conjugating enzymes (UbcH5 family recommended based on other poxviral E3 ligases), recombinant LAP, ubiquitin, ATP, and potential substrate proteins .

  • Monitor ubiquitin chain formation using Western blot with anti-ubiquitin antibodies or using tagged ubiquitin (His-Ub, FLAG-Ub).

  • Determine chain linkage specificity (K48 vs. K63) using linkage-specific antibodies or mass spectrometry analysis of the polyubiquitin chains.

Substrate identification approaches:

  • Immunoprecipitation of LAP followed by mass spectrometry to identify interacting partners.

  • Proximity-dependent biotin identification (BioID) or APEX2 approaches to identify proteins in close proximity to LAP during infection.

  • Global ubiquitinome profiling comparing cells with and without LAP expression to identify differentially ubiquitinated proteins.

  • CRISPR/Cas9 screening to identify host factors whose knockout rescues cells from LAP-mediated effects .

Structural and binding studies:

  • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to characterize binding interactions between LAP and E2 enzymes or potential substrates.

  • Crystallography or cryo-EM to determine the three-dimensional structure of LAP alone or in complex with binding partners.

  • Mutagenesis of key residues in the RING domain (particularly the zinc-coordinating cysteines) to confirm the structural basis of enzymatic activity .

Cellular functional assays:

  • Monitor localization of GFP-tagged LAP in infected or transfected cells.

  • Assess the impact of LAP expression on key immune signaling pathways (NF-κB, IRF3, STAT1) using reporter assays.

  • Measure degradation rates of candidate substrates in the presence/absence of LAP using cycloheximide chase assays or fluorescent timers.

  • Compare viral replication and host response in cells infected with wild-type SWPV versus LAP-knockout viruses .

What are the known or predicted substrates of Swinepox virus E3 ubiquitin-protein ligase LAP in host cells?

While the specific substrates of Swinepox virus E3 ubiquitin-protein ligase LAP have not been definitively identified in the provided research materials, we can make evidence-based predictions based on the targets of other poxviral E3 ligases and the conservation of immune evasion strategies across the Poxviridae family:

Predicted categories of LAP substrates:

Potential Substrate CategoryRationaleComparable Poxviral E3 Ligase Examples
Interferon pathway componentsMost poxviral E3 ligases target interferon signalingVACV E3 targets IRF3, PKR, and ISG15 pathway
NF-κB pathway componentsCentral to antiviral immunity in mammalsCowpox CP77 and Vaccinia K1L target NF-κB activation
PRR signaling componentsPrevent initial virus sensingPoxviral MARCH proteins target TLR pathway components
Apoptosis mediatorsPrevent premature cell deathECTV 010 targets RIPK3 to prevent necroptosis
MHC componentsEvade T cell recognitionCPXV 008 (MARCH) downregulates MHC-I

The specific porcine immune components targeted by LAP are likely to reflect the strict host specificity of SWPV, which infects only swine . Research to identify LAP substrates would benefit from comparative studies with other poxviral E3 ligases, particularly focusing on swine-specific immune factors.

Based on the E3 ligase homology, LAP likely catalyzes K48 and/or K63 ubiquitin linkages, which could lead to either proteasomal degradation of target proteins (K48) or altered signaling pathways (K63) . The relatively small size of LAP (155 amino acids) compared to other poxviral E3 ligases suggests it may have a more specialized function, possibly targeting a specific subset of host immune factors critical for SWPV replication in swine cells.

How can researchers generate and validate a functional knockout of the LAP gene in Swinepox virus to study its role in viral pathogenesis?

Generating and validating a functional knockout of the LAP gene in Swinepox virus requires a systematic approach combining molecular virology techniques with functional validation:

Generation of LAP knockout virus:

  • Homologous recombination strategy:

    • Design a transfer vector containing flanking regions of the LAP gene with a selection marker (e.g., GFP) inserted in place of the LAP coding sequence .

    • Co-transfect the transfer vector into permissive cells (porcine kidney cells) infected with wild-type SWPV.

    • Select recombinant viruses through fluorescence-based sorting and plaque purification .

  • CRISPR/Cas9-mediated editing:

    • Design guide RNAs targeting the LAP gene in the SWPV genome.

    • Co-transfect guide RNAs and Cas9 into cells infected with SWPV.

    • Screen for edited viruses using PCR and sequencing.

    • Plaque purify to obtain clonal knockout viruses.

Validation of LAP knockout:

  • Molecular validation:

    • PCR confirmation of the desired genetic modification.

    • Whole-genome sequencing to confirm the knockout and detect any off-target mutations.

    • RT-PCR and Western blot analysis to confirm the absence of LAP mRNA and protein expression .

  • Functional validation:

    • Compare growth kinetics between wild-type and ΔLAP viruses in multiple cell types.

    • Measure viral titers at different time points post-infection.

    • Examine plaque morphology and size.

    • Assess cytopathic effects in infected cells using microscopy and cell viability assays .

  • In vivo validation:

    • Conduct animal infection studies comparing wild-type and ΔLAP viruses.

    • Monitor clinical signs, viral loads, and immune responses in infected pigs.

    • Perform histopathological examination of tissues from infected animals.

    • Measure local and systemic immune responses to characterize the impact of LAP deletion .

  • Complementation studies:

    • Construct a recombinant ΔLAP virus expressing LAP from an ectopic locus to demonstrate that phenotypic changes are specifically due to LAP deletion.

    • Create point mutants in the RING domain to determine which residues are critical for LAP function.

The comparative analysis between wild-type SWPV and the LAP knockout mutant would provide valuable insights into the specific role of this E3 ligase in viral replication, host immune evasion, and pathogenesis, similar to studies conducted with other poxviral E3 ligase knockouts .

How can recombinant Swinepox virus E3 ubiquitin-protein ligase LAP be used as a tool to study host-pathogen interactions?

Recombinant Swinepox virus E3 ubiquitin-protein ligase LAP provides a powerful tool for investigating host-pathogen interactions through multiple experimental approaches:

As a probe for immune pathway components:

  • Express tagged LAP in porcine cells to identify binding partners through co-immunoprecipitation followed by mass spectrometry analysis.

  • Use LAP as "bait" in yeast two-hybrid screens to identify potential host protein interactions.

  • Employ recombinant LAP in in vitro pull-down assays to validate direct protein-protein interactions with candidate host factors .

As a tool for ubiquitinome analysis:

  • Compare the global ubiquitination profiles of cells expressing LAP versus control cells using ubiquitin remnant profiling by mass spectrometry.

  • Identify specific ubiquitination sites on target proteins that are modified in the presence of LAP.

  • Characterize the types of ubiquitin chains (K48, K63, etc.) formed on target proteins to predict functional outcomes of the modification .

For dissecting species-specific immune evasion:

  • Express LAP in cells from different species to determine if its immune evasion functions are specific to porcine hosts.

  • Compare ubiquitination patterns in porcine versus non-porcine cells to identify swine-specific immune factors targeted by LAP.

  • Use LAP to identify unique aspects of the porcine innate immune system that may not be present in other model organisms .

For comparative virology applications:

  • Compare the substrate specificity and mechanisms of LAP with other poxviral E3 ligases to understand the evolution of viral immune evasion strategies.

  • Create chimeric E3 ligases combining domains from LAP and other viral E3 ligases to map functional determinants of substrate specificity.

  • Use knowledge of LAP mechanisms to predict and test immune evasion strategies of related viruses .

For understanding viral host range restriction:

  • Determine whether LAP contributes to the strict host range of SWPV through its interactions with host proteins.

  • Express LAP in non-permissive cells to determine if it can overcome specific host restrictions to SWPV replication.

  • Map the regions of LAP that contribute to host-specific functions through domain swapping with E3 ligases from viruses with broader host ranges .

What potential applications exist for recombinant Swinepox virus E3 ubiquitin-protein ligase LAP in the development of novel antiviral strategies?

Recombinant Swinepox virus E3 ubiquitin-protein ligase LAP offers several promising applications for developing novel antiviral strategies:

Target for antiviral drug development:

  • High-throughput screening of small molecule libraries to identify inhibitors of LAP E3 ligase activity.

  • Structure-based drug design targeting the RING domain to disrupt E2 enzyme binding.

  • Development of peptide inhibitors that mimic binding interfaces between LAP and its substrates.

  • Creation of protein-based inhibitors that act as decoys for LAP, preventing it from targeting host immune factors .

Vaccine vector development:

  • Modification of the LAP gene in recombinant SWPV vaccine vectors to attenuate virulence while maintaining immunogenicity.

  • Creation of LAP mutants that preserve viral replication but reduce immune evasion capability.

  • Development of SWPV-based vectors expressing modified LAP alongside heterologous antigens from other swine pathogens .

A prominent example is the use of Swinepox virus as a vaccine vector against Classical Swine Fever Virus (CSFV). Research has shown that recombinant SWPV expressing the glycoprotein E2 of CSFV (rSPV-E2) can provide significant protection against CSFV infection in pigs. Similar approaches could be applied to modify LAP while incorporating antigens from other pathogens .

Immunomodulatory applications:

  • Engineering LAP derivatives that selectively degrade specific immune components to treat autoimmune conditions.

  • Using LAP to target specific inflammatory mediators in porcine disease models.

  • Developing LAP-based tools for controlled modulation of immune signaling pathways in experimental settings .

Diagnostic applications:

  • Using knowledge of LAP-substrate interactions to develop diagnostic assays for poxvirus infections.

  • Creation of antibodies against LAP for immunohistochemical detection of SWPV-infected cells.

  • Development of activity-based probes to monitor LAP function during infection .

Basic research applications:

  • Using LAP as a model to understand poxvirus E3 ligase evolution and host adaptation.

  • Studying LAP to identify novel components of porcine innate immunity that could be targeted to treat other diseases.

  • Employing LAP to understand fundamental aspects of host-restricted poxvirus infections .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.