Recombinant Swinepox virus G-protein coupled receptor homolog C3 (C3L)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Swinepox Virus G-Protein Coupled Receptor Homolog C3 (C3L)

Recombinant Swinepox Virus G-Protein Coupled Receptor Homolog C3 (C3L) is a biotechnologically engineered protein derived from the C3L gene of Swinepox virus (SWPV), a member of the Suipoxvirus genus. This protein is expressed in Escherichia coli systems with an N-terminal hexahistidine (His) tag for purification and detection purposes . The C3L protein is implicated in immune evasion mechanisms, resembling host G-protein coupled receptors (GPCRs) to modulate cellular signaling pathways during infection .

Functional Role in Viral Pathogenesis

C3L acts as a virulence factor by mimicking host GPCRs to disrupt immune responses:

  • Immune Evasion: SWPV C3L shares functional similarities with vaccinia virus (VACV) C3L, inhibiting protein kinase R (PKR) to block host antiviral defenses .

  • Host Range Expansion: Recombinant SWPV expressing C3L can infect non-swine cell lines, suggesting a broader tropism facilitated by this protein .

  • Interferon Antagonism: SWPV C3L homologs (e.g., SPV008, SPV011) suppress interferon (IFN)-γ and interleukin-18 (IL-18) signaling, enhancing viral survival .

4.1. Vaccine Development

Recombinant SWPV expressing C3L has been utilized as a vector for heterologous antigen delivery. For example:

  • SWPV expressing VP60 of Rabbit Hemorrhagic Disease Virus (RHDV) induced neutralizing antibodies and protected rabbits from lethal infection .

  • C3L deletion mutants are explored for attenuated vaccine candidates to reduce immune suppression .

4.2. Mechanistic Studies

  • PKR Inhibition Assays: C3L competes with eukaryotic initiation factor 2α (eIF2α) for PKR binding, preventing phosphorylation and translational shutdown .

  • Host-Pathogen Interactions: C3L’s role in modulating chemokine signaling is studied using yeast two-hybrid systems and recombinant protein overexpression .

Comparative Analysis with Other Poxvirus GPCRs

VirusGPCR HomologFunctionHost Range Impact
Swinepox virus (SWPV)C3LPKR inhibition, IFN antagonismBroadens cell tropism
Vaccinia virus (VACV)C3L (VCP)Complement system evasionEnhances systemic spread
Myxoma virus (MYXV)M-T7Chemokine bindingLimits leukocyte migration

SWPV C3L is phylogenetically closer to capripoxviruses (e.g., lumpy skin disease virus) than orthopoxviruses .

Diagnostic and Epidemiological Relevance

  • PCR Detection: SWPV C3L is a target for real-time PCR assays to diagnose swinepox outbreaks .

  • Genetic Variability: Indian SWPV C3L strains exhibit 98% amino acid identity with German and U.S. isolates but diverge in immune evasion domains .

Table: SWPV C3L Sequence Identity Across Strains

StrainIdentity with Russian SWPVKey Mutation Sites
USA (17077-99)100%None reported
Germany (SWPV/domestic)100%None reported
India (Spv/As-IND/01/14)98%A27V, D89G in PKR-binding region

Challenges and Future Directions

  • Structural Resolution: Lack of crystallographic data limits mechanistic insights into C3L-PKR interactions .

  • Vaccine Optimization: Balancing attenuation and immunogenicity in C3L-deleted SWPV requires further study .

  • Epidemiological Monitoring: C3L sequence divergence necessitates region-specific diagnostic tools .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
C3L; G-protein coupled receptor homolog C3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Swinepox virus (strain Kasza) (SWPV)
Target Names
C3L
Target Protein Sequence
MSDCIFVFQIPFIVYSKLDQWIFGNILCKIMSVLYYVGFFSNMFIITLMSIDRYFAIVHP IKRQPYRTKRIGILMCCSAWLLSLILSSPVSKLYENIPHMSKDIYQCTLTNENDSIIAFI KRLMQIEITILGFLIPIIIFVYCYYRIFSTVVRLRNRRKYKSIKIVLMIVVCSLICWIPL YIVLMIATIVSLYTSNIFRHLCLYLNLAYAITFSETISLARCCINPIIYTLIGEHVRSRI SSICSCIYRDNRIRKKLFSRKSSSSSNII
Uniprot No.

Target Background

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Host cell membrane; Multi-pass membrane protein.

Q&A

What makes swinepox virus a suitable vector for recombinant protein expression?

Swinepox virus (SPV) possesses several advantageous characteristics for recombinant protein expression in vaccine development. SPV has a large 146 kb double-stranded DNA genome that replicates in the cytoplasm of host cells, providing substantial packaging capacity for recombinant DNA . Its host specificity is strictly limited to swine, which provides an inherent safety advantage when developing porcine vaccines . Natural SPV infections typically cause only mild symptoms with localized skin lesions that heal naturally.

The virus demonstrates excellent ability to induce both cellular and humoral immune responses, making it particularly valuable for vaccine development . Additionally, recombinant SPV constructs have shown remarkable genetic stability, with studies demonstrating that constructs like rSPV-E2 maintain consistent culture titers (approximately 4.3 × 10^6 TCID₅₀) for more than 60 passages in porcine cell lines .

How does the host range restriction of swinepox virus impact experimental design?

The strict host tropism of swinepox virus significantly influences experimental design considerations. Research has demonstrated that while recombinant SPV constructs can be propagated in porcine cell lines such as PK15 and swine testis cells, they cannot replicate in non-porcine cell lines including Vero and MDBK . This host restriction is so pronounced that after just 2-3 passages in non-porcine cell cultures, SPV-specific genes become undetectable .

This host restriction has several experimental implications:

  • Cell line selection: Experiments must be conducted in appropriate porcine cell lines

  • Safety profile: The inability to replicate in non-porcine cells provides an inherent biosafety advantage

  • In vivo applications: The virus cannot cause disease in non-swine species

  • Experimental controls: Validation studies must account for the strict host tropism

  • Translation potential: Applications are naturally limited to swine-specific applications

When designing experiments involving recombinant SPV expressing C3L, researchers must account for these host range restrictions while leveraging them as an advantage for swine-specific applications.

What are the optimal methods for constructing recombinant swinepox virus expressing G-protein coupled receptor homologs?

Construction of recombinant swinepox virus expressing G-protein coupled receptor homologs like C3L typically employs homologous recombination techniques. Based on established protocols for similar constructs, the recommended methodology involves:

  • Vector preparation: Create a transfer vector containing:

    • Left and right flanking sequences from the SPV genome for homologous recombination

    • A strong promoter (such as P11 or P28 from vaccinia virus)

    • Multiple cloning sites for insertion of the target gene

    • A reporter gene (such as GFP) for selection of recombinants

  • Target gene preparation:

    • Amplify the C3L gene using PCR with primers containing appropriate restriction sites

    • Clone the amplified fragment into the transfer vector

    • Verify the sequence integrity

  • Homologous recombination:

    • Infect porcine cells (PK15 or ST) with wild-type SPV

    • Transfect the infected cells with the transfer vector

    • Select recombinant viruses based on reporter gene expression

    • Purify recombinant viruses through plaque purification

  • Verification:

    • Confirm recombination by PCR

    • Verify protein expression using Western blot

    • Assess localization using immunofluorescence assays

This methodology has been successfully employed for other recombinant SPV constructs, such as rSPV-E2, and can be adapted for G-protein coupled receptor homologs with appropriate modifications .

What cell culture systems best support the expression and functional analysis of swinepox virus-expressed G-protein coupled receptors?

For optimal expression and functional analysis of SPV-expressed G-protein coupled receptors like C3L, the following cell culture systems are recommended:

Primary expression systems:

  • PK15 (porcine kidney) cells: Shown to support robust replication of recombinant SPV with titers reaching approximately 4.3 × 10^6 TCID₅₀

  • Swine testis (ST) cells: Demonstrate comparable support for recombinant SPV replication

Functional analysis considerations:

  • Receptor signaling assays: Despite SPV's host restriction, downstream signaling assays may be performed in non-porcine cells transfected with the purified receptor

  • Calcium flux measurements: For GPCRs involved in calcium signaling

  • cAMP assays: For GPCRs coupled to adenylyl cyclase

  • β-arrestin recruitment assays: To assess receptor internalization dynamics

When studying viral GPCRs like C3L, it's important to remember they often demonstrate constitutive activity or altered signaling compared to their mammalian counterparts. Therefore, experimental controls should include both uninfected cells and cells infected with wild-type SPV to distinguish receptor-specific effects from those caused by viral infection .

For long-term studies, researchers should monitor genetic stability using sequencing and functional assays across multiple passages, as has been demonstrated for other recombinant SPV constructs .

What are the key considerations when designing in vivo experiments to evaluate immunomodulatory effects of SPV-expressed C3L?

When designing in vivo experiments to evaluate the immunomodulatory effects of SPV-expressed C3L, researchers should consider:

Experimental groups design:

  • Recombinant SPV-C3L group

  • Wild-type SPV control group (essential for distinguishing C3L-specific effects)

  • PBS or mock-infected control group

  • Positive control group (if applicable)

Sample size determination:
Studies with similar recombinant SPV constructs have demonstrated statistical significance with 5 animals per group , but power analysis should be conducted based on expected effect sizes.

Immunological parameters to monitor:

  • Antibody responses: ELISA for specific antibodies and virus neutralization assays

  • Cytokine profiles: Including but not limited to IFN-γ and IL-4 to assess Th1/Th2 balance

  • Cellular immunity: Flow cytometry to assess T-cell populations and activation states

  • Viral load: qPCR to quantify viral genomic copies in serum and tissues

Sampling timeline:
Comprehensive monitoring should include pre-immunization (day 0) and regular intervals post-immunization (typically days 7, 14, 21, 28, and 35) .

Clinical monitoring:
Daily monitoring of clinical signs including rectal temperature, appetite, behavior, and any visible adverse effects .

Ethical considerations:
Established humane endpoints should be clearly defined. Previous studies used criteria such as "signs of irreversible illness" with humane euthanasia using 100% CO₂ concentration .

How can researchers optimize promoter selection for maximal expression of G-protein coupled receptors in recombinant swinepox virus systems?

Optimizing promoter selection for maximal expression of GPCRs in recombinant SPV systems requires systematic evaluation of several factors:

Promoter comparison matrix:

Promoter TypeTemporal ExpressionExpression LevelSuitability for GPCRsExample Applications
P11 (Vaccinia)Early-lateHighGood for constitutive expressionSuccessfully used in SPV recombinants
P28 (Vaccinia)LateVery highMay cause overexpression issuesUsed in high-expression constructs
P7.5 (Vaccinia)Early-lateModerateBalanced expressionCommon in poxvirus vectors
Synthetic promotersCustomizableTunableAllows precise controlEmerging application
Native SPV promotersVariableVariableMay provide species-specific expressionLimited documentation

Optimization strategies:

  • Construct multiple variants: Generate recombinant SPV expressing C3L under different promoters

  • Quantitative comparison: Measure expression levels using Western blot and flow cytometry

  • Functional assessment: Evaluate receptor signaling capacity under different expression levels

  • Temporal analysis: Assess expression kinetics over the infection cycle

  • Cell-type testing: Compare expression across different porcine cell lines

Special considerations for GPCRs:
GPCRs can cause cellular toxicity when overexpressed, potentially leading to receptor misfolding, aggregation, or constitutive activation. Therefore, the strongest promoter may not always be optimal. For G-protein coupled receptor homologs like C3L, moderate but stable expression is often preferable to maximize the proportion of correctly folded, functional receptors at the cell surface.

Previous successful recombinant SPV constructs have utilized vaccinia virus promoters P11 and P28 in tandem expression systems, which might provide a starting point for C3L expression optimization .

What statistical approaches are most appropriate for analyzing immune responses induced by recombinant SPV expressing immunomodulatory proteins?

When analyzing immune responses induced by recombinant SPV expressing immunomodulatory proteins like C3L, the following statistical approaches are recommended:

For antibody titer data:

  • Log transformation: Antibody titers should be log₂-transformed prior to statistical analysis to normalize distribution

  • Repeated measures ANOVA: For tracking antibody development over time within groups

  • Mixed-effects models: To account for individual variation while assessing group differences

  • Post-hoc tests: Tukey's or Bonferroni corrections for multiple comparisons

For cytokine measurements:

  • Non-parametric tests: Often necessary as cytokine data frequently violates normality assumptions

  • Mann-Whitney U test: For comparing two groups

  • Kruskal-Wallis with Dunn's post-hoc test: For comparing multiple groups

For viral load quantification:

Example from relevant research:
In a comparable study with recombinant SPV expressing CSFV E2, researchers found significant differences in viral genomic copies between immunized and control groups using appropriate statistical methods. The analysis showed that serum CSFV genomic copies in the rSPV-E2 immunized group were significantly lower (P < 0.01) compared to control groups at all time points post-challenge .

For proper statistical reporting, researchers should clearly state:

  • Statistical tests employed

  • P-value thresholds

  • Software packages used

  • Whether assumptions for parametric tests were verified

  • Effect sizes in addition to P-values

What are the most challenging aspects of interpreting functional studies of viral G-protein coupled receptor homologs, and how can these challenges be addressed?

Interpreting functional studies of viral GPCRs like C3L presents several unique challenges:

Distinguishing viral GPCR functions from host responses to infection

  • Challenge: Viral infection triggers numerous host signaling cascades that may overlap with GPCR signaling pathways

  • Solution: Include appropriate controls including wild-type virus infection, inactive receptor mutants, and specific GPCR antagonists

Constitutive activity versus ligand-induced signaling

  • Challenge: Viral GPCRs often display constitutive activity independent of ligand binding

  • Solution: Use inverse agonists, site-directed mutagenesis of key residues, and heterologous expression systems to differentiate between constitutive and ligand-induced activities

Identification of relevant ligands

  • Challenge: Natural ligands for viral GPCR homologs may be unknown or differ from host receptor ligands

  • Solution: Employ unbiased screening approaches including:

    • Ligand library screening

    • Bioluminescence resonance energy transfer (BRET) assays

    • Functional genomics approaches

Signaling bias and pathway selectivity

  • Challenge: Viral GPCRs often demonstrate biased signaling compared to their host counterparts

  • Solution: Comprehensively evaluate multiple downstream pathways:

    • G-protein coupling specificity (Gαs, Gαi, Gαq, Gα12/13)

    • β-arrestin recruitment

    • Receptor internalization

    • Heterotrimeric G-protein independent signaling

Context-dependent functions

  • Challenge: Receptor function may differ between in vitro and in vivo systems

  • Solution: Validate findings across multiple experimental systems:

    • Different cell types

    • Ex vivo tissue models

    • Animal models where feasible

    • Correlate with clinical or field observations

A comprehensive approach combining molecular, cellular, and in vivo techniques is essential to accurately characterize viral GPCR functions and their role in viral pathogenesis or immune evasion.

How can recombinant swinepox virus expressing C3L be evaluated for its potential as a vaccine vector or immune modulator?

Evaluating recombinant SPV expressing C3L as a vaccine vector or immune modulator requires a systematic approach across multiple parameters:

Immunogenicity assessment:

  • Antibody responses:

    • Measure C3L-specific antibodies using ELISA

    • Assess neutralizing antibody titers if applicable

    • Monitor antibody persistence over time (studies with similar constructs show significant antibody responses by 7 days post-immunization)

  • Cellular immunity evaluation:

    • Quantify IFN-γ production by ELISPOT or intracellular cytokine staining

    • Measure T-cell proliferation in response to specific antigens

    • Assess cytokine profiles (e.g., IFN-γ, IL-4) to determine Th1/Th2 balance

Vector performance metrics:

  • Genetic stability: Verify construct stability over multiple passages (>60 passages recommended based on similar constructs)

  • Expression consistency: Confirm consistent C3L expression levels in vitro and in vivo

  • Tissue tropism: Characterize distribution in vaccinated animals

Safety evaluation:

  • Local reactions: Monitor injection site for inflammation, granuloma formation

  • Systemic reactions: Track body temperature, appetite, and behavior

  • Pathology: Perform histopathological examination of relevant tissues

  • Viral shedding: Assess potential for environmental spread

Protection assessment:
If C3L is being evaluated as part of a vaccine strategy:

  • Challenge studies: Expose immunized animals to relevant pathogen

  • Viral load quantification: Measure pathogen levels using qPCR

  • Clinical protection: Assess reduction in clinical signs compared to controls

  • Pathological evaluation: Score lesions in challenged animals

Similar recombinant SPV constructs have demonstrated significant protection against viral challenges, with reduced viral load, milder clinical signs, and less severe pathological changes compared to controls .

What are the current limitations in using viral G-protein coupled receptor homologs in vaccine development, and how might these be overcome?

Current limitations in utilizing viral GPCR homologs like C3L in vaccine development include several technical and biological challenges:

Immunomodulatory effects

  • Limitation: Viral GPCRs often function to subvert host immune responses

  • Solution: Engineer modified versions with immunostimulatory rather than immunosuppressive properties through targeted mutations

Safety concerns

  • Limitation: Some viral GPCRs have been associated with oncogenic potential or aberrant signaling

  • Solution: Develop attenuated versions with key signaling domains modified, while retaining immunogenic epitopes

Antigenic variability

  • Limitation: Limited cross-protection against diverse viral strains

  • Solution: Identify conserved epitopes across viral strains and focus on these regions in recombinant constructs

Adjuvant formulation challenges

  • Limitation: Optimal presentation of membrane proteins like GPCRs

  • Solution: Develop specialized adjuvant formulations that preserve conformational epitopes of membrane proteins

Expression efficiency

  • Limitation: As multi-pass membrane proteins, GPCRs can be difficult to express correctly

  • Solution: Optimize codon usage, signal sequences, and expression systems for correct folding and membrane insertion

Innovation pathways:

  • Structural vaccinology approaches: Design immunogens based on key epitopes rather than whole protein

  • Prime-boost strategies: Use recombinant SPV-C3L in heterologous prime-boost regimens

  • Adjuvant co-expression: Engineer SPV to co-express both C3L and immunostimulatory molecules

  • Chimeric constructs: Create fusion proteins combining C3L with other immunogenic antigens

Research with other recombinant SPV constructs has demonstrated the feasibility of creating multivalent vaccines expressing multiple antigens, suggesting similar approaches could be applied to C3L-based vaccines .

How might structural biology approaches enhance our understanding of viral G-protein coupled receptor homologs expressed in recombinant viral systems?

Structural biology approaches offer powerful insights into viral GPCR homologs like C3L and can significantly enhance recombinant viral vector development:

X-ray crystallography applications:

  • Receptor structure determination: Elucidate the three-dimensional structure of C3L to understand its unique features compared to mammalian GPCRs

  • Ligand-binding pockets: Identify key interaction sites for potential ligands or antagonists

  • Structure-guided mutations: Design modified receptors with altered signaling properties for vaccine applications

Cryo-electron microscopy advantages:

  • Membrane protein visualization: Visualize C3L in its native membrane environment

  • Conformational states: Capture different activation states of the receptor

  • Macromolecular complexes: Characterize interactions with G-proteins and other signaling partners

NMR spectroscopy contributions:

  • Dynamic analysis: Study the conformational dynamics of C3L

  • Ligand screening: Identify and characterize ligand interactions in solution

  • Local structure determination: Focus on specific domains or regions of interest

Computational approaches:

  • Homology modeling: Predict C3L structure based on related GPCRs

  • Molecular dynamics simulations: Study receptor behavior in membranes

  • Virtual screening: Identify potential ligands or antagonists

  • Epitope prediction: Identify potential B and T cell epitopes for vaccine design

Implementation strategy:

  • Expression optimization: Develop methods for high-level expression in insect or mammalian cells

  • Purification protocols: Establish detergent screening and purification workflows

  • Stability engineering: Introduce mutations that enhance stability for structural studies

  • Antibody-assisted crystallization: Generate conformation-specific antibodies to stabilize specific states

The structural insights gained would inform rational design of recombinant SPV vectors expressing modified C3L proteins with enhanced immunogenicity or altered signaling properties for vaccine applications.

What emerging technologies might revolutionize research on viral immune evasion strategies mediated by G-protein coupled receptor homologs?

Several emerging technologies hold promise for transforming our understanding of viral immune evasion mediated by GPCR homologs like C3L:

CRISPR-Cas9 genome editing

  • Application: Generate precise modifications in viral GPCR genes or host interaction partners

  • Potential: Create libraries of C3L mutants to map structure-function relationships

  • Innovation: CRISPR screens to identify host factors required for C3L-mediated immune evasion

Single-cell technologies

  • Application: Analyze heterogeneity in immune cell responses to viral GPCRs

  • Potential: Single-cell RNA-seq to characterize transcriptional changes in different immune cell populations

  • Innovation: Single-cell proteomics to map signaling pathway alterations at the individual cell level

Spatial transcriptomics

  • Application: Map the tissue-specific effects of viral GPCRs in infected hosts

  • Potential: Visualize immune modulation in the context of tissue architecture

  • Innovation: Combine with multiplexed imaging to correlate receptor expression with immune cell infiltration

Organoid models

  • Application: Study viral GPCR functions in physiologically relevant 3D tissue models

  • Potential: Create porcine tissue-specific organoids to evaluate SPV-C3L effects

  • Innovation: Immune-competent organoid systems to model host-pathogen interactions

Advanced imaging techniques

  • Application: Visualize viral GPCR trafficking and signaling in real-time

  • Potential: Super-resolution microscopy to track C3L localization during infection

  • Innovation: Optogenetic control of GPCR signaling to precisely manipulate viral receptor functions

Systems biology approaches

  • Application: Integrate multi-omics data to build comprehensive models of viral GPCR function

  • Potential: Identify network-level perturbations caused by C3L expression

  • Innovation: Predictive modeling of immune response modulation for vaccine optimization

The integration of these technologies could revolutionize our understanding of how viral GPCRs like C3L manipulate host immune responses and lead to novel approaches for developing more effective recombinant viral vector vaccines.

What are the most effective protocols for measuring immune responses to G-protein coupled receptor homologs expressed in recombinant swinepox virus?

Comprehensive evaluation of immune responses to GPCR homologs like C3L expressed in recombinant SPV requires multiple complementary assays:

Humoral immunity assessment protocols:

  • ELISA for antibody detection:

    • Coat plates with purified recombinant C3L protein

    • Incubate with serially diluted serum samples from immunized animals

    • Detect using anti-porcine IgG conjugated to appropriate enzyme

    • Calculate endpoint titers or concentrations using standard curves

    • Include pre-immune sera as negative controls

  • Conformational antibody detection:

    • Flow cytometry using cells expressing C3L on their surface

    • Indirect immunofluorescence assays on SPV-C3L infected cells

    • Western blotting under non-reducing conditions to detect conformation-dependent antibodies

Cellular immunity assessment protocols:

  • Interferon-γ ELISPOT:

    • Isolate peripheral blood mononuclear cells (PBMCs)

    • Stimulate with C3L peptide pools covering the entire sequence

    • Enumerate spot-forming cells using automated readers

    • Include positive controls (mitogen stimulation) and negative controls

  • Intracellular cytokine staining:

    • Stimulate PBMCs with C3L peptides in the presence of protein transport inhibitors

    • Surface stain for T-cell markers (CD3, CD4, CD8)

    • Fix, permeabilize, and stain for intracellular cytokines (IFN-γ, TNF-α, IL-2)

    • Analyze by flow cytometry

  • Cytokine profiling:

    • Collect serum samples at defined intervals (days 0, 7, 14, 21, 28, 35)

    • Measure cytokine levels using multiplex assays or ELISA

    • Focus on Th1/Th2 balance indicators (IFN-γ/IL-4 ratio)

Functional assays:

  • Neutralization assays (if applicable):

    • Determine if anti-C3L antibodies can block receptor function

    • Measure signaling outputs (e.g., calcium flux, cAMP) in the presence of immune sera

  • Antibody-dependent cellular cytotoxicity (ADCC):

    • Evaluate if anti-C3L antibodies can mediate ADCC against cells expressing the receptor

These protocols should be adapted based on the specific research questions and the hypothesized immune mechanisms relevant to the C3L protein.

What quality control measures should be implemented when producing and characterizing recombinant swinepox virus expressing G-protein coupled receptor homologs?

Rigorous quality control is essential when producing and characterizing recombinant SPV expressing GPCRs like C3L. A comprehensive QC pipeline should include:

Genetic integrity verification:

  • PCR verification:

    • Design primers spanning the insertion site and the C3L gene

    • Verify correct insertion and orientation

    • Sequence the entire insert and flanking regions

  • Whole genome sequencing:

    • Perform next-generation sequencing of the entire viral genome

    • Confirm absence of unwanted mutations or rearrangements

    • Verify genetic stability across multiple passages

  • Expression verification:

    • Western blot analysis using C3L-specific antibodies to confirm expression

    • Immunofluorescence assays to verify cellular localization

    • Flow cytometry to quantify expression levels

Biological characterization:

  • Growth kinetics:

    • Measure viral titers over multiple time points

    • Compare growth curves with wild-type SPV

    • Verify stable titers across passages (target: ~4.3 × 10^6 TCID₅₀)

  • Host range verification:

    • Confirm growth in permissive porcine cell lines

    • Verify inability to replicate in non-porcine cells

    • Document absence of SPV genes after 2-3 passages in non-permissive cells

  • Functional assays:

    • Verify C3L protein functionality using appropriate signaling assays

    • Compare signaling profiles with predicted activities

    • Document any modifications to host cell responses

Production consistency:

  • Batch-to-batch comparisons:

    • Implement lot release testing protocols

    • Maintain master and working virus banks

    • Document passage history and stability

  • Standardization metrics:

    • Establish potency assays for consistent dosing

    • Develop quantitative assays for C3L expression levels

    • Set acceptance criteria for each quality attribute

Safety testing:

  • Adventitious agent testing:

    • Verify absence of bacterial or fungal contamination

    • Screen for mycoplasma contamination

    • Confirm absence of other viral contaminants

  • Genetic stability during scale-up:

    • Monitor insert stability during production scale-up

    • Verify absence of reversion to wild-type

  • In vitro safety profiling:

    • Assess cell viability and cytotoxicity profiles

    • Compare with wild-type virus controls

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.