Recombinant Sympetrum striolatum Cytochrome c oxidase subunit 2 (COII)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Sympetrum striolatum (Common darter dragonfly) (Libellula striolata)
Target Names
COII
Target Protein Sequence
MATWAQLNFQDAASPMMEQLHYFHDHTMMVLVIITIMVAYIMGTMFFNKDVNRYLLDGQK IETEWTIVPVFVLVIIAMPSLRLLYLLDEVNEPSITLKTIGHQWYWSYEYSDFKHIEFDS YMIPYNEMEESGLRLLEVDNRTTLPMQTQVRILITAADVLHSWTVPSLGIKVDATPGRLN QTSFFINRPGIFFGQCSEICGANHSFMPIMIESVNIKSFINWIQNMSEA
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit 2 (COII) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes cooperate to transfer electrons from NADH and succinate to molecular oxygen, generating a proton gradient across the inner mitochondrial membrane. This gradient drives ATP synthesis. COII plays a crucial role in cytochrome c oxidase's function, catalyzing the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred through the CuA center of subunit II and heme a of subunit I to the binuclear center (heme a3 and CuB) in subunit I. This binuclear center utilizes four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce oxygen to two water molecules.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of Cytochrome c oxidase subunit 2 in Sympetrum striolatum?

Cytochrome c oxidase subunit 2 (COII) in Sympetrum striolatum is encoded within the mitochondrial genome, which has been fully assembled and is 16.16 kilobases in length . The COII gene is part of the essential mitochondrial respiratory chain components. The complete genome sequence of S. striolatum spans 1349.6 megabases with most of the assembly scaffolded into 12 chromosomal pseudomolecules, including the X sex chromosome . Understanding this genomic context is crucial for designing appropriate primers and expression constructs that accurately represent the native protein sequence.

The mitochondrial genome assembly for S. striolatum has been deposited as a contig within the multifasta file of the genome submission, with the assembly accession GCA_947579665.1 . Researchers should note that the estimated Quality Value (QV) of the final assembly is 62.4 with k-mer completeness of 100%, indicating high reliability for gene sequence extraction.

What expression systems are available for recombinant production of S. striolatum COII, and how do they compare?

Multiple expression systems have been developed for the recombinant production of S. striolatum COII, each with distinct advantages depending on research requirements:

Expression SystemProduct ID ExampleAdvantagesBest Applications
E. coliCSB-EP015073SRY1High yield, economic, rapid expressionStructural studies, antibody production
YeastCSB-YP015073SRY1Post-translational modifications, proper foldingFunctional studies requiring eukaryotic processing
BaculovirusCSB-BP015073SRY1Insect-derived system, closer to native environmentStudies requiring authentic folding, interaction studies
Mammalian cellCSB-MP015073SRY1Most authentic post-translational modificationsComplex functional assays, protein-protein interactions

E. coli-based expression systems offer the advantage of producing His-tagged full-length COII protein (1-229aa) , making purification more straightforward through affinity chromatography. For studies requiring biotinylated protein, the in vivo biotinylation system using AviTag-BirA technology (product CSB-EP015073SRY1-B) provides specifically biotinylated protein where biotin is covalently attached to the AviTag peptide .

The choice of expression system should be guided by the intended application, with E. coli being suitable for structural studies while mammalian systems may be preferred for functional characterization requiring authentic post-translational modifications.

What are the optimal conditions for purifying recombinant S. striolatum COII from inclusion bodies?

Purification of recombinant S. striolatum COII from inclusion bodies requires a carefully optimized refolding protocol. While specific conditions for COII from S. striolatum are not directly provided in the search results, the Design of Experiments (DoE) approach has been successfully applied to similar protein refolding challenges, as demonstrated in a 2002 study optimizing Cathepsin S refolding .

A methodological approach would include:

  • Inclusion body isolation using multiple washing steps with detergents and reducing agents

  • Solubilization in chaotropic agents (typically 6-8M urea or guanidine hydrochloride)

  • Refolding through dilution or dialysis using a DoE approach to optimize multiple variables simultaneously:

    • Protein concentration

    • Redox couple (GSH/GSSG) ratio

    • pH

    • Ionic strength

    • Temperature

    • Presence of additives (L-arginine, glycerol, etc.)

The power of DoE lies in its ability to explore multiple variables simultaneously rather than using the One-Factor-At-A-Time (OFAT) approach. For a refolding optimization with 5 factors, a fractional factorial design with a center point would require only 9-16 experiments instead of potentially dozens using traditional approaches .

How can Design of Experiments (DoE) be applied to optimize expression conditions for S. striolatum COII?

Design of Experiments (DoE) represents a significant advancement over traditional One-Factor-At-A-Time (OFAT) experimental approaches for optimizing recombinant protein expression, including S. striolatum COII. Unlike OFAT, which varies single factors sequentially while keeping others constant, DoE enables simultaneous variation of multiple factors, exploring their interactions and identifying optimal conditions more efficiently .

For optimizing S. striolatum COII expression, a typical DoE approach would:

  • Identify critical factors affecting expression (temperature, inducer concentration, media composition, harvest time)

  • Establish appropriate ranges for each factor

  • Design a factorial or fractional factorial experiment

  • Include center points to detect non-linear relationships

  • Execute experiments in randomized order to minimize bias

  • Analyze results using statistical software to identify significant factors and interactions

  • Develop a predictive model for optimal conditions

  • Conduct verification experiments at predicted optimal conditions

For example, with three factors each set at two levels plus a center point, only 9 experimental runs would be required (versus 27 for a full exploration) . The experimental space can be visualized as a cube with experimental conditions at the corners and center, providing comprehensive coverage of the variable space with minimal experimental effort.

This approach is particularly valuable for membrane proteins like COII, where expression conditions critically affect proper folding and functionality.

What methodological considerations are important when comparing COII sequences across different dragonfly species for evolutionary studies?

When conducting evolutionary studies comparing COII sequences across dragonfly species, several methodological considerations are essential:

  • Sampling strategy: Include appropriate taxonomic breadth within Odonata, particularly within Libellulidae. The phylogenetic position of S. striolatum has been established as closely related to the Asian species Brachythemis contaminata based on mitochondrial genomic data .

  • Sequence verification: Confirm the authenticity of sequences through bidirectional sequencing and comparison with reference data. The complete COII sequence from S. striolatum provides a valuable reference point (UniProt: P29880) .

  • Alignment methodology: Use appropriate algorithms for protein-coding genes that preserve codon structure and account for the high AT-richness typical of insect mitochondrial genomes.

  • Model selection: Apply appropriate evolutionary models that account for the specific substitution patterns of mitochondrial genes. The availability of the complete mitogenome of S. striolatum allows for calibration of these models .

  • Integration with morphological data: The case of Highland Darter (once known as S. nigrescens) illustrates the importance of integrating molecular and morphological data - despite morphological differences suggesting separate species status, shared CO1 haplotypes with S. striolatum indicate it may be a melanistic variant adapted to colder northern habitats .

The complete mitochondrial genome of S. striolatum was previously sequenced from a specimen from the Altay Region in China and used to produce a mitochondrial phylogeny of 29 Odonata species, supporting the monophyly of Libellulidae .

How can recombinant S. striolatum COII be utilized in structural biology studies?

Recombinant S. striolatum COII offers multiple avenues for structural biology investigations when proper experimental design is implemented:

  • X-ray crystallography: His-tagged recombinant COII expressed in E. coli (product RFL6171SF) provides material amenable to purification for crystallization trials. The availability of the full-length protein (229 amino acids) allows for structural determination of the complete functional unit.

  • Cryo-electron microscopy: For membrane proteins like COII, cryo-EM increasingly offers advantages over crystallography, particularly when studying the protein within the context of the complete cytochrome c oxidase complex. Expression in mammalian or insect cells may provide more native-like protein for these studies.

  • Structure-function relationship analysis: The ability to produce biotinylated COII using AviTag-BirA technology enables surface immobilization for binding studies using surface plasmon resonance or bio-layer interferometry to correlate structural features with interaction patterns.

  • Comparative structural biology: With the complete genome and mitogenome of S. striolatum now available , researchers can design comparative structural studies between COII from different dragonfly species to investigate structural adaptations related to environmental conditions.

A methodological workflow would begin with expressing COII in an appropriate system (E. coli for crystallography, mammalian cells for cryo-EM), followed by purification optimized through DoE approaches, and subsequent structural determination through the chosen technique. The high purity (>90% by SDS-PAGE) of commercially available recombinant preparations provides a solid starting point for such studies.

What approaches are most effective for studying the functional aspects of recombinant S. striolatum COII in oxidative phosphorylation research?

Studying the functional aspects of recombinant S. striolatum COII in oxidative phosphorylation research requires carefully designed experimental approaches that maintain the protein's native properties while enabling quantitative assessment:

  • Reconstitution into proteoliposomes: Purified recombinant COII should be reconstituted with other components of the cytochrome c oxidase complex into artificial membrane systems. The purity of recombinant preparations (>90% by SDS-PAGE) is critical for avoiding confounding factors.

  • Oxygen consumption assays: Polarographic measurements using oxygen electrodes can assess the functional activity of reconstituted complexes containing recombinant COII. These assays should include appropriate controls with known inhibitors of cytochrome c oxidase.

  • Proton pumping efficiency: The dual function of cytochrome c oxidase in electron transfer and proton pumping can be assessed using pH-sensitive probes in reconstituted systems.

  • Interaction with cytochrome c: The interaction between recombinant COII and cytochrome c can be studied using the biotinylated version of the protein (CSB-EP015073SRY1-B) , immobilized on streptavidin surfaces for binding studies.

  • Comparative studies across species: The established phylogenetic relationship between S. striolatum and other dragonfly species provides a framework for comparative functional studies investigating adaptation of oxidative phosphorylation efficiency to different ecological niches.

For quantitative assessment, researchers should employ DoE approaches to optimize assay conditions, particularly for reconstitution protocols where multiple variables (lipid composition, protein:lipid ratio, buffer conditions) interact to determine functional outcomes .

What are the most common challenges in expressing functional S. striolatum COII, and how can they be addressed?

Common challenges in expressing functional S. striolatum COII include:

  • Membrane protein solubility issues: As a mitochondrial membrane protein, COII is inherently hydrophobic and prone to aggregation.

    • Solution: Test multiple detergents using a DoE approach to identify optimal solubilization conditions . Consider fusion partners that enhance solubility while maintaining native conformation.

  • Improper folding in heterologous systems: E. coli-expressed COII may not adopt native conformation due to differences in membrane composition and folding machinery.

    • Solution: Consider expression in eukaryotic systems like yeast, baculovirus, or mammalian cells that provide more appropriate folding environments for mitochondrial proteins.

  • Loss of co-factors during purification: COII function depends on metal co-factors that may be lost during purification.

    • Solution: Supplement purification buffers with appropriate metal ions and consider gentler purification approaches that maintain native co-factor binding.

  • Protein degradation: The lyophilized powder format of commercial preparations may lead to activity loss upon reconstitution.

    • Solution: Follow strict reconstitution protocols, avoiding repeated freeze-thaw cycles . Store working aliquots at 4°C for up to one week to maintain activity.

  • Quality control challenges: Verifying the functional integrity of purified COII requires specialized assays.

    • Solution: Develop a multi-parameter quality control workflow including SDS-PAGE for purity assessment, circular dichroism for secondary structure verification, and functional assays measuring electron transfer activity.

How can researchers optimize the design of experiments when investigating S. striolatum COII in comparative mitochondrial function studies?

When designing experiments for comparative mitochondrial function studies involving S. striolatum COII, researchers should consider these methodological optimizations:

  • Application of factorial DoE: Rather than the traditional OFAT approach, implement factorial DoE to simultaneously evaluate multiple experimental variables. For a study with 3-5 factors, this approach can reduce experimental runs while providing greater insight into factor interactions .

  • Visualization of experimental space: Conceptualize the experimental design as a multidimensional space where each variable represents one dimension. For three factors each set at two levels with a center point, this creates a cube with experimental conditions at the corners and center .

  • Strategic selection of comparison species: Based on phylogenetic information from the mitochondrial genome sequencing of S. striolatum, which revealed close relationship with Brachythemis contaminata , select species that represent appropriate evolutionary distances for meaningful comparative studies.

  • Normalization strategies: Develop robust normalization approaches that account for variations in recombinant protein activity across preparations from different species. Consider internal controls and standard reference materials.

  • Data integration frameworks: Establish computational frameworks that integrate multiple data types (sequence, structure, activity) to create comprehensive models of evolutionary adaptations in mitochondrial function.

The analysis of such complex datasets benefits significantly from statistical approaches embedded in DoE software, which can identify not only main effects but also interaction effects that might be missed in traditional experimental designs .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.