Recombinant Synaptogyrin homolog 1 (sng-1)

Shipped with Ice Packs
In Stock

Description

SV Biogenesis and Trafficking

  • C. elegans: SNG-1 localizes to SVs and colocalizes with synaptotagmin (SNT-1) and synaptobrevin (SNB-1). Its synaptic localization depends on UNC-104/KIF1A, a kinesin responsible for SV transport .

  • Drosophila: Loss of synaptogyrin (gyr mutants) disrupts SV biogenesis at neuromuscular junctions but does not impair viability or basic motor function, suggesting a modulatory role .

  • Mammalian systems: Rat synaptogyrin retains synaptic localization in C. elegans, indicating conserved trafficking signals .

Interactions With Trafficking Machinery

  • SNG-1-containing vesicles exhibit co-transport with lysosomal markers (CTNS-1, RAB-7) in lrk-1 (LRRK2 homolog) and apb-3 (AP-3 complex subunit) mutants, implicating SNG-1 in SV-lysosome hybrid organelle formation .

  • SYD-2/Liprin-α facilitates UNC-104-dependent transport of SNG-1 in C. elegans, linking SNG-1 to active zone regulation .

Key Experimental Systems

ModelApplicationFindings
C. elegans (GFP/ARGO-tagged SNG-1)Live imaging of SV protein turnoverSNG-1 turnover rate: ~2.5 days (half-life)
Drosophila (gyr-null mutants)Analysis of SV biogenesis defectsAltered SV morphology without behavioral defects
Hippocampal neurons (rat synaptogyrin)Conservation of synaptic targeting mechanismsFunctional homology with C. elegans SNG-1

Innovative Methods

  • ARGO (Analysis of Red-Green Offset): A ratiometric fluorescence tool to track SNG-1 turnover in vivo. This method revealed that SNG-1 is sorted for degradation at synapses but degraded in cell bodies .

Turnover Dynamics and Proteostasis

  • Degradation pathway: SNG-1 is trafficked retrograde to cell bodies for lysosomal degradation, with clearance from synapses as the rate-limiting step .

  • Aging effects: SNG-1 turnover slows in older neurons, highlighting age-dependent declines in proteostasis .

Pathophysiological Implications

While SNG-1 itself is not directly linked to human disease, its mammalian homolog SYNGR1 is associated with synaptic plasticity and neuropsychiatric disorders. Studies in C. elegans and Drosophila provide mechanistic insights into conserved pathways disrupted in neurodegenerative diseases .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
sng-1; T08A9.3; Synaptogyrin homolog 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
sng-1
Target Protein Sequence
MENVRAYGAGLAGANFDKNTFFKKPTVLFRCAALLFGLILWYSVSKGGWHKPSDAIHPVC LYGRSSSTCSFATAVGFFAVCGAIVLIVLDAKMDQISSVPTRRRAVLADLVVSAIFTAIF LIGFFTFWSKLSAFEVDEDDENPIKTNNAKFGILSALLSFLAWGGAAFFAWRRYEEGNQA THEPNYDEHFGQVSTDVQDGYGYGGDSTGIGHVGAPPPQSSYQSGAAPQTMQQPPSNPYT QSEGYGY
Uniprot No.

Target Background

Gene References Into Functions
  1. These observations attribute a distinct modulatory and redundant neuronal function to synaptogyrin. PMID: 21689733
Database Links

KEGG: cel:CELE_T08A9.3

STRING: 6239.T08A9.3

UniGene: Cel.19525

Protein Families
Synaptogyrin family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in a wide variety of neurons and is expressed weakly in the non-neuronal distal tip cells. A punctate pattern was observed in the ventral and dorsal nerve cords and the nerve ring. Weak expression is seen in neuronal cell bodies and commissures.

Q&A

What is Synaptogyrin homolog 1 (SNG-1) and what is its biological function?

Synaptogyrin homolog 1 (SNG-1) is an evolutionarily conserved, integral synaptic vesicle (SV) protein that regulates synaptic vesicle cycling in organisms from nematodes to mammals . In Caenorhabditis elegans, SNG-1 shares approximately 30% identity with rat synaptogyrin and exhibits a similar hydrophobicity profile . Functionally, SNG-1 plays a critical role in neurotransmission, as loss of sng-1 leads to resistance to the acetylcholinesterase inhibitor aldicarb, suggesting reduced synaptic vesicle release compared to wild-type organisms . The protein's importance in neuronal function is further highlighted by its conservation across species, indicating a fundamental role in synaptic physiology.

Where is SNG-1 expressed and localized within neurons?

SNG-1 is predominantly expressed in neurons where it localizes specifically to presynaptic terminals . Both native SNG-1 and GFP-tagged SNG-1 show clear synaptic localization patterns in C. elegans neurons . Within neurons, SNG-1 is integrated into synaptic vesicle membranes and can also be found in acidic compartments such as late endosomes and autophagosomes during protein turnover processes . Interestingly, the distribution of SNG-1 can vary between different neuron types; for example, the NSM neuron has a higher proportion of presynaptic SNG-1 within acidic compartments compared to the DA9 neuron, as demonstrated by different steady-state GFP/RFP ratios in ARGO-tagged SNG-1 .

How does SNG-1 compare to mammalian synaptogyrin proteins?

SNG-1 in C. elegans functions similarly to mammalian synaptogyrin proteins despite having only 30% sequence identity . The conserved function is evidenced by the fact that GFP-tagged rat synaptogyrin can localize correctly to synaptic regions when expressed in C. elegans . Both C. elegans SNG-1 and mammalian synaptogyrin contain critical targeting sequences that direct the protein to synaptic vesicles. Specifically, a 38 amino acid sequence within the C-terminus and a single arginine in the cytoplasmic loop between transmembrane domains 2 and 3 are required for proper localization in SNG-1 . These functional similarities make SNG-1 a valuable model for studying the broader synaptogyrin protein family.

What methods are available for visualizing SNG-1 localization and dynamics in vivo?

Several complementary methods exist for visualizing SNG-1 localization and dynamics in living organisms:

  • GFP-tagged SNG-1: The fusion of GFP to SNG-1 allows for direct visualization of the protein's localization in living neurons using fluorescence microscopy . This approach has been used to study the synaptic targeting of SNG-1 and to identify specific amino acid sequences required for this localization.

  • ARGO (Analysis of Red Green Offset): This novel method enables visualization of protein turnover with subcellular resolution . ARGO employs a dual-fluorophore system where the protein of interest is tagged with both RFP and GFP, with GFP being removable via Cre-lox recombination. This creates a "pulse" of single-labeled protein that can be tracked over time to measure turnover rates.

  • Immunocytochemistry: Researchers can use antibodies against SNG-1 for fixed-tissue analysis. A polyclonal antibody generated against amino acids 164-248 of SNG-1 has been successfully used for immunolocalization studies .

When selecting a visualization method, researchers should consider whether they need to observe static localization patterns or dynamic processes such as protein turnover and trafficking.

How can researchers generate recombinant SNG-1 constructs for functional studies?

To generate recombinant SNG-1 constructs for functional studies, researchers can follow these methodological steps:

  • PCR amplification: Design primers that flank the coding region of sng-1. For C. elegans sng-1, the complete coding sequence can be amplified from genomic DNA or cDNA libraries.

  • Restriction enzyme cloning: Include appropriate restriction enzyme sites in your primers. For example, in the construction of rat synaptogyrin, researchers used BglII and AgeI sites .

  • Vector selection: Choose an expression vector appropriate for your experimental system. For C. elegans studies, vectors containing cell-type specific promoters are often used to drive expression in neurons.

  • Fluorescent protein tagging: For visualization, SNG-1 can be tagged with fluorescent proteins. When designing fusion constructs, consider placing the tag at either the N- or C-terminus, being mindful that the C-terminal region contains a 38-amino acid sequence essential for localization .

  • Validation of construct function: Test whether your recombinant SNG-1 localizes correctly and maintains normal function. For example, a functional SNG-1::ARGO construct should localize to presynapses and should not cause aldicarb resistance when expressed in neurons .

Specific examples of successful SNG-1 expression constructs include pSY12 for rat synaptogyrin expression in C. elegans, which was created by PCR amplification using primers targeting the beginning and end of the coding region .

What is the ARGO method and how can it be applied to study SNG-1 turnover?

The ARGO (Analysis of Red Green Offset) method is a recently developed technique for visualizing protein turnover with high spatial and temporal resolution in vivo . Here's how it works and how to apply it to SNG-1 studies:

Principle of ARGO:

  • The protein of interest (SNG-1) is tagged with both RFP and GFP fluorophores

  • GFP is flanked by loxP sites, allowing for its removal via Cre recombinase activation

  • Heat-shock inducible Cre recombinase provides temporal control

  • After GFP excision, the protein is labeled only with RFP

  • New protein synthesis results in dual-labeled protein (both RFP and GFP)

  • The ratio of GFP/RFP intensity decreases over time as older (RFP-only) protein is degraded

Application to SNG-1 studies:

  • Generate the SNG-1::ARGO construct with both fluorophores

  • Create transgenic C. elegans expressing SNG-1::ARGO and heat-shock promoter-driven Cre recombinase

  • Apply heat shock (34°C for 1 hour) to activate Cre recombinase

  • Image neurons at different time points after heat shock

  • Analyze the GFP/RFP ratio at individual synapses over time

  • Fit the data to a single-phase exponential decay function to determine the apparent half-life of SNG-1

This method has revealed that SNG-1 has an apparent presynaptic half-life of approximately 2.5 days in adult C. elegans (Day 2 of adulthood) . The technique allows for analysis of protein turnover with subcellular resolution, enabling researchers to compare turnover rates across different synapses within the same neuron or between different neuron types.

What molecular mechanisms control SNG-1 turnover and degradation at synapses?

The molecular mechanisms controlling SNG-1 turnover and degradation involve several coordinated processes:

  • Surveillance and sorting at the presynapse: SNG-1 is initially surveilled and sorted for degradation at the presynaptic terminal . This sorting involves targeting the protein to acidic compartments like late endosomes, as evidenced by the differential GFP/RFP ratios observed in the steady-state (prior to ARGO activation) .

  • Retrograde transport: After sorting, SNG-1 destined for degradation is trafficked from the presynapse to the neuron cell body . This trafficking is not rate-limiting for turnover, as demonstrated by the uniform turnover rates observed across proximal and distal presynapses .

  • Cell-body degradation: The final degradation of SNG-1 occurs in the neuron cell body, completing the turnover process .

  • Age-dependent regulation: The rate of SNG-1 turnover changes with age. In C. elegans, the apparent half-life increases from 1.6 days in newly mature adults (Day 0) to 3.9 days in older adults (Day 6) . This suggests age-related changes in the degradation machinery or in the susceptibility of SNG-1 to degradation.

Importantly, research using the ARGO method has revealed that the rate-limiting step for SNG-1 degradation is neither the surveillance nor the sorting for degradation, but rather the clearance of sorted-for-degradation SNG-1 from the presynapse .

What specific amino acid sequences or motifs are critical for SNG-1 localization and function?

Specific amino acid sequences critical for SNG-1 localization have been identified through deletion and mutational analysis:

  • C-terminal targeting sequence: A 38 amino acid sequence within the C-terminus of SNG-1 is required for proper localization . This region may represent a signal that targets synaptogyrin for endocytosis from the plasma membrane.

  • Cytoplasmic loop arginine: A single arginine in the cytoplasmic loop between transmembrane domains 2 and 3 is essential for SNG-1 localization to synaptic vesicles .

These localization domains have functional significance, as demonstrated by chimeric studies where these regions were sufficient to relocalize cellugyrin (a non-neuronal form of synaptogyrin) from non-synaptic regions such as sensory dendrites and cell bodies to synaptic vesicles . This indicates that these sequences contain the necessary information to direct proteins to synaptic vesicles.

The conservation of these targeting mechanisms is further supported by the observation that rat synaptogyrin correctly localizes to synaptic regions when expressed in C. elegans neurons , suggesting that the molecular machinery recognizing these localization signals is evolutionarily conserved.

How does SNG-1 function differ across different neuron types or developmental stages?

SNG-1 function exhibits notable differences across neuron types and developmental stages:

Neuron-type specific differences:

  • The steady-state proportion of SNG-1 in acidic compartments varies between neuron types. In NSM neurons, a higher proportion of presynaptic SNG-1 is found within acidic compartments compared to DA9 neurons (GFP/RFP ratios of 1.6 versus 2.0, respectively) .

  • Despite these differences in steady-state distribution, the apparent half-life of SNG-1 is similar between these neuron types (2.3 days in NSM versus 2.6 days in DA9) , suggesting that turnover regulation occurs at the whole-neuron level rather than at individual synapses.

Developmental and age-related changes:

  • Synapses undergo significant growth (over 100%) between Day 0 and Day 2 of adulthood in C. elegans, and additional presynapses are added during this period .

  • SNG-1 turnover rate changes with age: the apparent presynaptic half-life increases from 1.6 days at Day 0 to 2.5 days at Day 2, and further increases to 3.9 days by Day 6 of adulthood .

  • After Day 2 of adulthood, presynapse size (based on SNG-1::RFP intensity) and number stabilize, suggesting a transition from a developmental to a maintenance phase .

These observations indicate that SNG-1 function and regulation are not static but adapt to the specific requirements of different neuron types and change throughout the lifespan of the organism.

How can researchers accurately quantify SNG-1 turnover rates and half-life?

Accurate quantification of SNG-1 turnover rates and half-life requires careful experimental design and data analysis:

Experimental approach:

  • Use the ARGO method to create a temporal "pulse" of differentially labeled protein

  • Collect images at multiple time points after Cre recombinase activation

  • Ensure consistent imaging parameters across all time points

  • Include controls for photobleaching and imaging conditions

Quantification methods:

  • Measure GFP and RFP intensities at individual presynapses

  • Calculate the GFP/RFP ratio for each presynapse at each time point

  • Normalize the data to the initial GFP/RFP ratio (immediately after complete recombination)

  • Plot the normalized GFP/RFP ratio against time

  • Fit the data to a single-phase exponential decay function: Y = (Y0 - Plateau) × e^(-K×X) + Plateau

  • Calculate the half-life using the formula: t1/2 = ln(2)/K

Data presentation:
The following table summarizes SNG-1 apparent half-life measurements across different ages in C. elegans:

Age (Days of adulthood)Apparent SNG-1 Half-life (Days)95% Confidence Interval
Day 01.61.4 - 1.8
Day 22.52.3 - 2.8
Day 42.5 (stable from Day 2)2.3 - 2.8
Day 63.93.2 - 4.7

When interpreting turnover data, researchers should consider that during periods of synaptic growth (Day 0-2), the apparent half-life reflects both degradation of old protein and the addition of new synaptic material . Only once synapses reach a steady state (Day 2+) does the half-life measurement primarily reflect homeostatic turnover .

What controls should be included in SNG-1 localization and functional studies?

To ensure the validity and reliability of SNG-1 localization and functional studies, researchers should include several key controls:

For localization studies:

  • Wild-type comparison: Always compare recombinant SNG-1 localization to the native protein distribution using immunostaining with specific antibodies against SNG-1 .

  • Co-localization with other synaptic markers: Use established synaptic markers like synaptotagmin (SNT-1) to confirm synaptic localization .

  • Negative control regions: Examine non-synaptic regions (dendrites, cell bodies) to confirm specificity of synaptic localization .

  • Tagged protein functionality: Verify that the tagged protein retains normal function. For SNG-1, this can be tested using aldicarb resistance assays, where loss of sng-1 leads to resistance but functional SNG-1::ARGO has no discernible effect on aldicarb sensitivity compared to wild-type .

For turnover studies using ARGO:

  • Heat-shock only control: Assess whether heat shock treatment alters sng-1 mRNA levels or steady-state protein abundance. Previous studies have shown no significant difference in sng-1 mRNA levels either 5 hours or 1 day after heat shock .

  • Non-recombined control: Include animals that carry the ARGO construct but have not been heat-shocked to control for any leaky Cre expression or spontaneous recombination .

  • Steady-state measurements: Quantify average presynaptic SNG-1::ARGO intensity and presynapse number to ensure stability during the experiment .

  • Cell-wide measurements: For compartment-specific analyses, compare results across different subcellular regions within the same neuron to control for cell-wide effects .

By including these controls, researchers can distinguish between true biological effects and artifacts introduced by the experimental system or methodology.

How can researchers interpret contradictory data on SNG-1 function across different experimental systems?

When faced with contradictory data on SNG-1 function across different experimental systems, researchers should consider several factors:

Systematic approach to resolving contradictions:

  • Species-specific differences: While SNG-1 is evolutionarily conserved, there may be species-specific functions or interactions. Compare sequence homology and key functional domains between species to identify potential divergences .

  • Expression level variations: Different expression levels of recombinant SNG-1 can lead to conflicting results. Overexpression might cause mislocalization or dominant-negative effects. Quantify expression levels relative to endogenous protein when possible .

  • Tagging artifacts: Different tags or tag positions can interfere with protein function. Compare results using N-terminal versus C-terminal tags, and different types of fluorescent proteins. For SNG-1, consider that the C-terminal region contains localization signals that might be disrupted by tagging .

  • Neuronal subtype specificity: SNG-1 function may vary between neuronal subtypes. The study showing different GFP/RFP ratios between DA9 and NSM neurons suggests neuron-type specific differences in SNG-1 regulation .

  • Developmental timing: SNG-1 turnover rates change with age, from 1.6 days in Day 0 adults to 3.9 days in Day 6 adults . Ensure comparisons are made between experiments using animals of similar ages.

  • Methodological differences: Different methods for measuring protein function or turnover may yield different results. For example, pulse-chase versus steady-state measurements provide different information about protein dynamics.

To systematically address contradictions, design experiments that directly test competing hypotheses, ideally within the same experimental system. When this is not possible, carefully control for the variables listed above to make valid comparisons between different experimental approaches.

What are the key unanswered questions about SNG-1 structure and function?

Several critical questions about SNG-1 structure and function remain unanswered and represent important areas for future research:

  • Structural determinants of function: While localization signals have been identified , the complete three-dimensional structure of SNG-1 and how it relates to function remains poorly understood. How do the four transmembrane domains interact with synaptic vesicle membranes, and what structural changes occur during vesicle cycling?

  • Protein-protein interactions: What are the key binding partners of SNG-1 at the presynapse? How do these interactions regulate synaptic vesicle cycling and contribute to synaptic plasticity?

  • Post-translational modifications: How is SNG-1 modified post-translationally, and how do these modifications affect its function and turnover? Are there specific phosphorylation sites that regulate its activity or targeting for degradation?

  • Regulation during aging: What molecular mechanisms underlie the age-dependent slowing of SNG-1 turnover ? Is this due to changes in the degradation machinery, alterations in SNG-1 itself, or changes in the synaptic environment?

  • Cell-wide regulation: How is SNG-1 turnover coordinated across all synapses within a neuron to maintain the observed uniformity in degradation rates ? What signaling mechanisms allow for cell-wide regulation of protein turnover?

Addressing these questions will require combining advanced imaging techniques like ARGO with biochemical approaches, genetic manipulations, and potentially new methodologies for studying protein structure and interactions in vivo.

How can ARGO and other novel techniques advance our understanding of synaptic protein dynamics?

The ARGO method and other emerging techniques offer significant potential to advance our understanding of synaptic protein dynamics:

ARGO applications and extensions:

  • Multiplexed analysis: Applying ARGO to multiple synaptic proteins simultaneously could reveal coordinated turnover mechanisms and identify proteins with similar or divergent degradation pathways.

  • Activity-dependent turnover: Combining ARGO with optogenetic or chemogenetic stimulation could determine how neuronal activity regulates SNG-1 and other synaptic protein turnover rates.

  • Subcellular resolution: The high spatial resolution of ARGO enables analysis of protein turnover in specific compartments within the synapse, potentially revealing microdomains with distinct degradation kinetics .

  • Disease models: Applying ARGO in disease models could identify altered protein turnover as a mechanism underlying synaptic dysfunction in neurological disorders.

Complementary emerging techniques:

  • Proximity labeling: Techniques like BioID or APEX2 could identify proteins in close proximity to SNG-1 at different stages of its lifecycle, revealing degradation machinery components.

  • Super-resolution microscopy: Methods like STORM or PALM could provide nanoscale localization of SNG-1 within synaptic vesicles and during trafficking events.

  • Live-cell proteomics: Emerging methods for tracking protein modifications and degradation in living cells could complement the optical approach of ARGO.

  • Cryo-electron tomography: This technique could reveal the three-dimensional organization of SNG-1 within synaptic vesicles in near-native conditions.

By combining these approaches, researchers can develop a comprehensive understanding of SNG-1 dynamics throughout its lifecycle, from synthesis and trafficking to function at the synapse and eventual degradation.

What potential therapeutic applications might emerge from advanced understanding of SNG-1 biology?

Advanced understanding of SNG-1 biology could lead to several therapeutic applications:

  • Neurodegenerative disease interventions: Since SNG-1 turnover slows with age , understanding this process might reveal mechanisms of age-related synaptic dysfunction. Therapies that maintain proper SNG-1 turnover could potentially slow cognitive decline in disorders like Alzheimer's disease where synapse loss is a key feature.

  • Synaptic restoration strategies: Knowledge of SNG-1 localization signals could inform the development of molecular tools to enhance synaptic vesicle formation or recycling in conditions where these processes are impaired, such as in certain forms of epilepsy or following stroke.

  • Biomarkers of synaptic health: The turnover rate of SNG-1 and related proteins could serve as biomarkers for synaptic integrity and function. Techniques derived from ARGO might be adapted to assess synaptic health in patient-derived neurons.

  • Drug delivery systems: Understanding the trafficking and localization mechanisms of SNG-1 could inspire novel drug delivery systems that specifically target synaptic compartments, increasing the efficacy of neurotherapeutics while reducing side effects.

  • Modulation of neurotransmission: As SNG-1 regulates synaptic vesicle cycling , therapies that selectively modify its function could potentially treat disorders characterized by imbalanced neurotransmission, such as anxiety, depression, or schizophrenia.

While these applications remain speculative, they highlight the potential long-term clinical relevance of basic research on synaptic vesicle proteins like SNG-1. The development of such applications would require significant translational research bridging findings from model organisms to human neurons and clinical settings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.