Recombinant Synechococcus elongatus ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; Synpcc7942_0334; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-171
Protein Length
full length protein
Species
Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)
Target Names
atpF
Target Protein Sequence
MSSWILLAHAETSGFGLNLDLFETNLINLAIIIGLLVYAGRGFLGNLLSNRRAAIEAEIR EVEEKLASSAQALSQAQTQLKEAEAEAARLLVEAKARAAAVRQEILDKAAADVERLKATA AQDVSTEQQRVLDELRRYAVAQALSRVETQLSQQLDEAAQQRLIDRSLATL
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core; and the F0 domain, containing the membrane proton channel. These domains are linked by a central and a peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel and forms part of the peripheral stalk, connecting F1 and F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

How does atpF in Synechococcus elongatus differ from similar proteins in other photosynthetic organisms?

Synechococcus elongatus atpF shares the core structural features common to bacterial b subunits but possesses distinct characteristics adapted to its photosynthetic lifestyle. Unlike mitochondrial ATP synthase subunits that function primarily in respiration, the cyanobacterial atpF must coordinate with both respiratory and photosynthetic electron transport chains. This dual functionality necessitates unique structural adaptations not found in non-photosynthetic bacteria. For instance, whereas mitochondrial TFAM (which also impacts energy metabolism) functions primarily in DNA binding and transcription activation as seen in search result , cyanobacterial atpF's primary role is in maintaining the structural integrity of ATP synthase. The protein contains specific interaction domains that facilitate integration with the photosynthetic apparatus, enabling efficient energy conversion under varying light conditions. Additionally, regulatory elements in cyanobacterial atpF respond to redox state changes, allowing for adjustments in ATP synthesis rates based on photosynthetic activity. These adaptations highlight the specialized nature of Synechococcus elongatus atpF compared to its counterparts in other organisms.

What is the genomic organization of atpF in Synechococcus elongatus and how does it affect expression studies?

The atpF gene in Synechococcus elongatus is typically organized within the ATP synthase operon (atp operon), which contains genes encoding various ATP synthase subunits. Unlike some other cyanobacteria that contain split atpF genes requiring RNA splicing, Synechococcus elongatus generally possesses an intact atpF gene, simplifying recombinant expression strategies. The operon structure and promoter elements controlling atpF expression are subject to complex regulation mechanisms that respond to environmental factors such as light intensity and nutrient availability. When designing experiments for recombinant expression, researchers must consider these regulatory elements to achieve optimal expression levels. Additionally, as observed with other cyanobacterial genes, the presence of defense mechanisms like Argonaute (SeAgo) can impact genetic manipulation of atpF. SeAgo has been shown to reduce natural transformation efficiency and prevent maintenance of certain plasmid replicons in Synechococcus elongatus , which may complicate certain genetic engineering approaches for atpF studies.

How can Design of Experiments (DoE) be applied to optimize recombinant atpF expression?

Design of Experiments (DoE) offers a systematic approach to optimize recombinant Synechococcus elongatus atpF expression by examining multiple factors simultaneously. A well-structured DoE can significantly reduce experimental burden while identifying optimal conditions. The process should begin with screening designs to identify critical factors affecting expression. Two-level factorial or fractionate factorial designs are particularly valuable at this stage, as they allow assessment of multiple factors with relatively few experiments . For atpF expression, researchers should consider factors such as induction temperature (16-30°C), inducer concentration (0.1-1.0 mM IPTG), cell density at induction (OD₆₀₀ of 0.6-1.2), expression duration (4-24h), and media composition.

Using a 2⁵⁻¹ fractionate factorial design would require 16 experiments rather than 32 for a full factorial design, providing an efficient screening approach . After identifying significant factors, optimization designs such as response surface methodology (RSM) with central composite or Box-Behnken designs can pinpoint optimal conditions. The following table illustrates a sample fractionate factorial design for atpF expression optimization:

ExperimentTemperature (°C)IPTG (mM)OD₆₀₀Duration (h)Media TypeYield (mg/L)
1160.10.64LBData point
2300.10.64TBData point
.....................
16301.01.224TBData point

This methodical approach allows researchers to systematically identify optimal conditions for atpF expression while minimizing the number of experiments required .

What expression systems are most suitable for producing functional recombinant Synechococcus elongatus atpF?

Selecting the appropriate expression system is crucial for obtaining functional recombinant atpF. Several systems offer distinct advantages depending on research objectives:

Bacterial Expression Systems:
E. coli remains the most commonly used host, with specialized strains like C41/C43 being particularly suitable for membrane proteins like atpF. These strains contain mutations that prevent toxic effects often associated with membrane protein overexpression. For optimal results, expression vectors containing strong, inducible promoters (T7, tac) with appropriate fusion tags (His, MBP) should be employed. Typical expression conditions involve induction at lower temperatures (16-20°C) to promote proper folding.

Cell-Free Expression Systems:
For challenging membrane proteins like atpF, cell-free systems offer advantages by eliminating cellular toxicity concerns. These systems allow direct manipulation of reaction conditions, including addition of detergents or lipids to facilitate proper folding of membrane domains.

The choice between these systems should consider research goals, required protein quantity, and functional assay requirements.

What factors affect the stability and functional integrity of purified recombinant atpF?

Multiple factors impact the stability and functional integrity of purified recombinant Synechococcus elongatus atpF:

Detergent Selection and Concentration:
As a membrane protein, atpF requires carefully selected detergents for extraction and stabilization. Mild non-ionic detergents (DDM, LMNG) or zwitterionic detergents (LDAO) at concentrations slightly above their critical micelle concentration typically provide the best results. The detergent-to-protein ratio must be optimized to prevent protein aggregation while maintaining native structure.

Buffer Composition:
Buffer pH (typically 7.0-8.0), ionic strength (usually 100-300 mM salts), and the presence of specific additives significantly affect atpF stability. Divalent cations (Mg²⁺, Ca²⁺) may be required for proper folding and maintaining interactions with other ATP synthase subunits. Glycerol (10-20%) can enhance stability during storage and freeze-thaw cycles.

Lipid Environment:
As observed with other membrane proteins, the lipid environment plays a crucial role in atpF functionality. Addition of specific lipids during purification or reconstitution into liposomes or nanodiscs can significantly improve stability and activity.

Oxidation Prevention:
Exposure to oxidative conditions can damage sensitive residues in atpF. Including reducing agents (DTT, TCEP) and conducting purification under nitrogen atmosphere can preserve functional integrity.

Systematic evaluation of these factors through stability assays and functional tests is essential for developing conditions that maintain atpF in its native conformation.

What purification strategy yields the highest purity and activity for recombinant Synechococcus elongatus atpF?

Purification of recombinant Synechococcus elongatus atpF requires a multi-step approach optimized for membrane proteins. The following sequential strategy typically yields high purity while preserving activity:

Step 1: Membrane Extraction
Cell lysis using mechanical methods (sonication, French press) followed by differential centrifugation to isolate membrane fractions. Membranes are then solubilized with carefully selected detergents, typically 1% DDM or LMNG at 4°C for 1-2 hours. This step is critical for extracting atpF while maintaining its native conformation.

Step 2: Affinity Chromatography
For His-tagged atpF constructs, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin provides efficient initial purification. Binding is performed in buffer containing 0.05% detergent with stepwise imidazole washes (20-50 mM) to remove weakly bound contaminants, followed by elution with higher imidazole concentrations (250-300 mM).

Step 3: Size Exclusion Chromatography (SEC)
SEC using Superdex 200 or similar matrices separates oligomeric states and removes aggregates. The running buffer typically contains 0.03-0.05% detergent, 150 mM NaCl, and 20 mM Tris pH 7.5. This step is crucial for obtaining homogeneous protein preparations.

Step 4: Ion Exchange Chromatography (Optional)
For samples requiring higher purity, an additional ion exchange step can remove remaining contaminants based on charge differences.

Throughout the purification process, it's essential to monitor protein quality using SDS-PAGE, Western blotting, and pilot functional assays. This approach typically yields protein of >95% purity with preserved structural integrity. Similar methodological considerations have been shown effective for other recombinant proteins studied in membrane systems .

What analytical techniques are most informative for structural characterization of atpF?

Multiple complementary analytical techniques provide comprehensive structural characterization of Synechococcus elongatus atpF:

Spectroscopic Methods:
Circular dichroism (CD) spectroscopy provides information about secondary structure content and thermal stability. Far-UV CD spectra can confirm the predominantly α-helical structure expected for atpF, while thermal denaturation experiments assess stability under various conditions. Fourier-transform infrared spectroscopy (FTIR) offers additional structural insights, particularly for membrane-embedded regions.

Mass Spectrometry Approaches:
Native mass spectrometry can determine the oligomeric state and detect post-translational modifications. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) maps solvent accessibility and conformational dynamics, identifying regions involved in protein-protein interactions. These approaches require minimal sample amounts compared to other structural techniques.

High-Resolution Structural Methods:
X-ray crystallography provides atomic-level resolution if well-diffracting crystals can be obtained. Cryo-electron microscopy (cryo-EM) is increasingly powerful for membrane proteins like atpF, especially when studied in the context of the complete ATP synthase complex. For dynamic studies, nuclear magnetic resonance (NMR) spectroscopy can provide information about specific domains, though this typically requires isotopic labeling strategies.

Biophysical Interaction Analysis:
Surface plasmon resonance (SPR), isothermal titration calorimetry (ITC), and microscale thermophoresis (MST) characterize interactions between atpF and other ATP synthase subunits or small molecules. These techniques provide quantitative binding parameters (Kd, stoichiometry) essential for understanding complex assembly.

A comprehensive structural characterization typically requires combining multiple techniques to overcome limitations of individual methods.

What functional assays can verify the activity of recombinant atpF?

Verifying the functional activity of recombinant Synechococcus elongatus atpF requires specialized assays that assess both its structural role in ATP synthase assembly and its contribution to enzymatic function:

ATP Synthase Assembly Assays:
Co-purification experiments with other ATP synthase subunits can demonstrate proper subunit interaction. Blue native PAGE (BN-PAGE) visualizes intact ATP synthase complexes after reconstitution with purified subunits. Fluorescence resonance energy transfer (FRET) between labeled atpF and other subunits can monitor complex formation in real-time.

Proton Translocation Measurements:
Reconstitution of atpF with other ATP synthase components into liposomes allows measurement of proton pumping activity using pH-sensitive fluorescent dyes like ACMA or pyranine. This approach directly assesses whether atpF-containing complexes maintain the coupling between proton translocation and ATP synthesis/hydrolysis.

ATP Synthesis/Hydrolysis Assays:
ATP hydrolysis can be measured using colorimetric phosphate release assays or coupled enzyme systems. ATP synthesis capacity can be assessed after reconstitution into proteoliposomes and establishment of a proton gradient. These functional tests are particularly informative when comparing wild-type atpF with site-directed mutants.

Complementation Studies:
Expression of recombinant atpF in Synechococcus elongatus strains with atpF deletion can assess functional complementation through restoration of growth, ATP synthesis rates, or photosynthetic capacity. Such studies, while technically challenging due to transformation barriers potentially imposed by systems like SeAgo , provide the most physiologically relevant assessment of function.

Combining these assays provides a comprehensive evaluation of whether recombinant atpF maintains its native structure and function.

How can recombinant atpF be used to study energy metabolism in cyanobacteria?

Recombinant Synechococcus elongatus atpF serves as a powerful tool for investigating energy metabolism in cyanobacteria through several sophisticated research applications:

Bioenergetic Studies:
Reconstitution of ATP synthase complexes containing wild-type or modified atpF into liposomes allows measurement of proton translocation efficiency, ATP synthesis rates, and the proton-to-ATP ratio. These parameters provide insights into how atpF influences the energetic coupling efficiency in the ATP synthase complex. Similar approaches with recombinant proteins have demonstrated increased mitochondrial gene copy number, complex I protein levels, and ATP production rates in other systems .

Integration with Photosynthetic Machinery:
Proximity labeling approaches using atpF fused to enzymes like BioID or APEX2 can identify interactions between ATP synthase and photosynthetic complexes. These studies reveal how energy is transferred between light harvesting and ATP production under different environmental conditions.

These advanced applications provide deeper insights into the sophisticated energy metabolism of cyanobacteria and potential applications in biotechnology.

What role does atpF play in the coordination between photosynthesis and respiration in Synechococcus elongatus?

Synechococcus elongatus atpF occupies a unique position at the interface between photosynthetic and respiratory energy metabolism, playing crucial roles in their coordination:

Shared ATP Synthase Utilization:
In cyanobacteria, the same ATP synthase complex serves both photosynthetic and respiratory electron transport chains. AtpF's structural integrity is essential for maintaining this dual functionality. Research suggests that specific regions of atpF may interact differently with respiratory versus photosynthetic components, enabling appropriate energy conversion under varying conditions.

Redox-Dependent Regulation:
AtpF likely contains redox-sensitive elements that respond to changes in cellular redox state resulting from fluctuations in photosynthetic activity. These elements may influence ATP synthase assembly, conformation, or activity, thus modulating energy production based on cellular needs and environmental conditions.

Spatial Organization in Thylakoid Membranes:
AtpF contributes to the spatial arrangement of ATP synthase complexes within thylakoid and cytoplasmic membranes. This organization facilitates efficient energy transfer between respiratory and photosynthetic complexes, optimizing energy conservation. Advanced imaging techniques with tagged recombinant atpF can reveal these spatial relationships.

Response to Environmental Fluctuations:
AtpF's structural adaptations enable rapid responses to changing light conditions, allowing for smooth transitions between photosynthesis-dominated and respiration-dominated metabolism. This flexibility is crucial for cyanobacterial survival in fluctuating environments.

Understanding atpF's role in this coordination provides insights into the fundamental mechanisms of energy conversion in photosynthetic organisms and potential targets for enhancing bioenergetic efficiency.

How does the presence of Argonaute in Synechococcus elongatus affect genetic manipulation of the atpF gene?

Synechococcus elongatus possesses an active prokaryotic Argonaute nuclease (SeAgo) that functions as a defense mechanism against foreign DNA, presenting unique challenges for genetic manipulation of genes like atpF:

Transformation Efficiency Limitations:
SeAgo significantly reduces natural transformation efficiency in Synechococcus elongatus, potentially limiting the introduction of modified atpF constructs . Transformation frequencies may be substantially lower compared to other model organisms, requiring optimization of DNA delivery methods and increased DNA concentrations.

Plasmid Maintenance Challenges:
SeAgo prevents the maintenance of certain plasmid replicons, particularly RSF1010-based vectors, in Synechococcus elongatus . This limitation restricts the choice of vectors available for expressing recombinant atpF or for gene replacement strategies targeting the native atpF locus.

Strategies to Overcome SeAgo Interference:
Using an S. elongatus ago deletion strain significantly improves transformation efficiency and enables the use of RSF1010-based plasmids for genetic engineering . This modified strain maintains the same morphology, growth rate, and circadian gene expression as wild-type S. elongatus, making it suitable for atpF studies without compromising physiological relevance.

Experimental Design Considerations:
When manipulating atpF, researchers should verify construct integration and stability over multiple generations, as SeAgo may cause unexpected recombination or degradation of introduced DNA sequences. Design of DNA constructs should consider potential recognition patterns that might trigger SeAgo activity.

Understanding these defense mechanisms is crucial for successful genetic manipulation of the atpF gene and highlights the broader challenges in cyanobacterial genetic engineering.

What are the emerging applications of engineered atpF variants in biotechnology?

Engineered variants of Synechococcus elongatus atpF hold significant potential for various biotechnological applications:

Enhanced Biofuel Production:
Modifications to atpF that optimize ATP synthesis efficiency could significantly improve biofuel production in cyanobacterial systems. By engineering variants with altered proton-to-ATP ratios or improved stability under industrial conditions, researchers can potentially enhance cellular energy availability for biosynthetic pathways. This approach builds upon findings with other energy metabolism proteins like TFAM, which has demonstrated increased ATP production rates and decreased oxidative damage to proteins when administered in recombinant form .

Improved Photosynthetic Efficiency:
Strategic modifications to atpF could enhance the coupling between photosystems and ATP synthase, potentially improving photosynthetic efficiency and CO₂ fixation rates. Such improvements would be valuable for carbon capture technologies and increased biomass production.

Biosensors and Diagnostic Tools:
AtpF variants engineered with reporter domains or specific sensing capabilities could serve as biosensors for monitoring cellular energy status, proton gradient formation, or membrane potential in real-time. These tools would be valuable for basic research and industrial bioprocess monitoring.

Nanoscale Energy Conversion Devices:
The highly efficient rotary mechanism of ATP synthase, of which atpF is a critical component, has inspired development of biomimetic nanomotors. Engineered atpF variants could contribute to creating stable, efficient biological-mechanical hybrid devices for specialized applications in nanotechnology.

Pharmaceutical Applications:
Understanding how atpF functions in energy production could inform development of new antimicrobial agents targeting ATP synthase in pathogenic bacteria while sparing human ATP synthases. Similar therapeutic approaches with recombinant proteins targeting mitochondrial function have shown promise in models of Parkinson's disease and sepsis .

These emerging applications highlight the potential broader impacts of fundamental research on cyanobacterial atpF.

What methodological advances are needed to overcome current limitations in atpF research?

Several methodological challenges currently limit atpF research, requiring innovative approaches:

Improved Membrane Protein Expression Systems:
Development of specialized expression systems optimized for cyanobacterial membrane proteins would significantly advance atpF research. These could include engineered E. coli strains with modified lipid composition or cyanobacterial-derived cell-free expression systems that better mimic the native environment of atpF.

Advanced Structural Analysis Techniques:
While cryo-EM has revolutionized membrane protein structural biology, higher resolution structures of ATP synthase in different conformational states remain challenging. Development of improved sample preparation methods, detector technologies, and computational approaches would enhance our understanding of atpF's dynamic role in ATP synthase function.

High-Throughput Functional Assays:
Current functional assays for ATP synthase activity are often labor-intensive and low-throughput. Development of miniaturized, high-throughput assays would accelerate screening of atpF variants and identification of conditions affecting activity. Application of Design of Experiments (DoE) approaches, as described for pharmaceutical development , could significantly improve efficiency of such screening efforts.

Improved Genetic Tools for Cyanobacteria:
Despite recent advances, genetic manipulation of cyanobacteria remains challenging compared to model organisms like E. coli. Development of more efficient transformation methods that overcome defense mechanisms like SeAgo , expanded genetic toolkits with well-characterized promoters and regulatory elements, and improved genome editing techniques would accelerate atpF research in its native context.

In situ Analysis Methods:
Technologies allowing visualization and measurement of ATP synthase activity in living cyanobacterial cells would provide unprecedented insights into atpF function. These could include improved fluorescent probes for ATP, membrane potential, or pH, combined with advanced microscopy techniques.

Addressing these methodological challenges would significantly advance our understanding of atpF and its role in cyanobacterial energy metabolism.

How might atpF research contribute to understanding evolutionary adaptations in photosynthetic organisms?

Research on Synechococcus elongatus atpF provides valuable insights into the evolutionary adaptations of photosynthetic organisms:

Molecular Evolution of Energy Coupling Mechanisms:
Comparative analysis of atpF sequences and structures across diverse photosynthetic organisms reveals evolutionary changes that optimize energy coupling for different ecological niches. These studies illuminate how fundamental energy conversion mechanisms have been refined throughout the evolution of photosynthetic life.

Adaptation to Environmental Pressures:
AtpF variants from Synechococcus species adapted to different environments (temperature extremes, varying light conditions, nutrient limitations) provide natural experiments in protein evolution. Analyzing these variants reveals how selection pressures have shaped ATP synthase function to maintain efficiency under diverse conditions.

Endosymbiotic Gene Transfer Insights:
Comparing cyanobacterial atpF with chloroplast-encoded counterparts in algae and plants offers insights into the evolutionary consequences of endosymbiotic gene transfer. These comparisons reveal how integration of the photosynthetic apparatus into eukaryotic cellular contexts influenced ATP synthase structure and regulation.

Co-evolution with Defense Mechanisms:
The relationship between atpF genetic manipulation and defense systems like SeAgo raises interesting questions about how horizontal gene transfer and defense mechanisms have co-evolved in cyanobacteria. This interplay may have shaped the evolution of cyanobacterial genomes and their energy production machinery.

Convergent Evolution in Energy Systems:
Comparing ATP synthase b subunits across diverse organisms reveals instances of convergent evolution, where similar functional solutions evolved independently in different lineages. Such comparisons provide insights into biophysical constraints and optimal solutions for biological energy conversion.

These evolutionary insights extend beyond academic interest, potentially informing the design of more robust and efficient biological energy conversion systems for biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.