Recombinant Synechococcus elongatus ATP synthase subunit b' (atpG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF2; atpG; Synpcc7942_0333; ATP synthase subunit b'; ATP synthase F(0 sector subunit b'; ATPase subunit II; F-type ATPase subunit b'; F-ATPase subunit b'
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)
Target Names
atpG
Target Protein Sequence
MNAWMILAAEAVQEAEGGLFDLDATLPLMAVQILVLVFLLNAVFYKPFGKVLDDRDQFVR GGRQDAKARLAEVKALTAQYEQELAATRKQSQALIAEAQTEAGRIAAQQLAEAQREAQAQ REQAQQEIDQQKAVALQALDQQVDALSHQILDKLLARA
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembrane catalytic core; and the F0 domain, containing the membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. The b' subunit, a diverged and duplicated form of the b subunit found in plants and photosynthetic bacteria, is a component of the F0 channel and part of the peripheral stalk, linking F1 to F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

Technical Research Questions

  • What purification strategies yield the highest recovery of functional recombinant atpG from S. elongatus?

    Purifying functional recombinant atpG from S. elongatus requires specialized approaches that preserve the native structure of this membrane-associated protein:

    Extraction and solubilization protocol:

    1. Cell disruption:

      • Glass bead homogenization in buffer containing 50 mM Tris-HCl (pH 8.0), 10 mM MgCl₂, 1 mM PMSF

      • Alternative: French pressure cell at 20,000 psi for more efficient breakage

      • Perform all steps at 4°C with minimal exposure to light

    2. Membrane fraction isolation:

      • Differential centrifugation: Low-speed (10,000 × g, 10 min) to remove unbroken cells

      • Ultracentrifugation (150,000 × g, 1 hour) to collect membrane fraction

      • Wash membrane pellet to remove peripheral proteins

    3. Detergent solubilization:

      DetergentConcentrationAdvantagesLimitations
      n-dodecyl β-D-maltoside1%Preserves ATP synthase activityModerate extraction efficiency
      Digitonin1-2%Maintains protein-protein interactionsHigher cost, variable purity
      Triton X-1000.5-1%High extraction efficiencyMay disrupt some interactions

    Purification workflow:

    1. Affinity chromatography (for tagged atpG):

      • SyneBrick vectors allow incorporation of C-terminal His₆ or Strep-II tags

      • Ni-NTA or Strep-Tactin columns with detergent-containing buffers

      • Imidazole gradient (20-250 mM) or desthiobiotin (2.5 mM) elution

      • Include 0.05% detergent in all buffers to maintain solubility

    2. Ion exchange chromatography:

      • DEAE or Source-Q columns for additional purification

      • Salt gradient (50-500 mM NaCl) for elution

      • Analyze fractions by SDS-PAGE and Western blot

    3. Size exclusion chromatography:

      • Superdex 200 column for final polishing step

      • Assess oligomeric state and complex formation

      • Buffer composition: 20 mM Tris-HCl (pH 8.0), 100 mM NaCl, 5 mM MgCl₂, 0.03% appropriate detergent

    Functional validation:

    • Reconstitution into liposomes for activity assays

    • Circular dichroism to confirm secondary structure integrity

    • Binding assays with other ATP synthase subunits

    This comprehensive purification strategy adapts techniques that have been successful for other ATP synthase subunits while addressing the specific challenges of atpG purification.

  • How can researchers effectively determine the stoichiometry and assembly kinetics of atpG within the ATP synthase complex?

    Determining stoichiometry and assembly kinetics of atpG within the ATP synthase complex requires specialized analytical approaches:

    Stoichiometry determination:

    1. Quantitative mass spectrometry:

      • Label-free quantification using purified ATP synthase complexes

      • SILAC (Stable Isotope Labeling with Amino acids in Cell culture) adapted for cyanobacteria

      • Absolute quantification using isotope-labeled peptide standards

      • Analysis of atpG:other subunits ratios under different growth conditions

    2. Single-molecule fluorescence imaging:

      • Express fluorescently-tagged atpG using SyneBrick vectors

      • Utilize stepwise photobleaching to count subunits

      • Combine with other labeled subunits to determine relative stoichiometry

      • The SyneBrick system's compatibility with fluorescent proteins facilitates this approach

    3. Biochemical cross-linking coupled with SDS-PAGE:

      • Apply bifunctional cross-linkers with varying spacer lengths

      • Analyze cross-linked products by SDS-PAGE and Western blotting

      • Identify cross-linked residues by mass spectrometry

      • Model subunit arrangements based on cross-linking constraints

    Assembly kinetics analysis:

    1. Pulse-chase labeling with inducible expression:

      • Utilize the LacI-pTrc system in SyneBrick vectors for controlled induction

      • Apply IPTG pulse (1 mM) to initiate synthesis

      • Track incorporation into complexes using fractionation techniques

      • Monitor using Western blotting or fluorescence detection

    2. Real-time assembly monitoring:

      • Express atpG fused to a photoconvertible fluorescent protein

      • Convert protein at specific timepoints

      • Track movement and incorporation using time-lapse microscopy

      • Quantify assembly rates under different conditions

    3. In vitro reconstitution assays:

      • Purify individual ATP synthase components

      • Combine components under controlled conditions

      • Monitor assembly using native PAGE or analytical ultracentrifugation

      • Determine rate-limiting steps in complex formation

    Applications to research questions:

    Research QuestionRecommended ApproachExpected Outcome
    Does atpG stoichiometry change under stress?Quantitative MS after stress treatmentDetection of altered subunit ratios
    How quickly is atpG incorporated into complexes?Pulse-chase with inducible SyneBrick systemAssembly kinetics under different conditions
    Does atpG assembly precede or follow other subunits?Sequential pulse labeling of multiple subunitsTemporal assembly map of ATP synthase
    How do mutations affect incorporation efficiency?Comparative assembly assays with wild-type and mutantsIdentification of rate-limiting interactions

    These approaches leverage advanced analytical techniques and the versatility of the SyneBrick expression system to provide comprehensive insights into atpG stoichiometry and assembly dynamics within the ATP synthase complex.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.