Recombinant Synechococcus elongatus Cytochrome b6-f complex iron-sulfur subunit (petC)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Synechococcus elongatus Cytochrome b6-f Complex Iron-Sulfur Subunit (petC)

The cytochrome $$b_6f$$ (cyt $$b_6f$$) complex is a crucial component in oxygenic photosynthesis, linking linear electron transfer (LET) reactions between photosystems I and II, and generating a transmembrane proton gradient via the Q-cycle . This complex also participates in cyclic electron transfer (CET), state transitions, and photosynthetic control .

PetC (Rieske Iron-Sulfur Protein)

PetC is the Rieske iron-sulfur protein subunit of the cytochrome $$b_6f$$ complex . The cyt $$b_6f$$ complex from Nostoc sp. PCC 7120 has a stable dimeric structure, with eight subunits similar in mass to those of M. laminosus, and comparable electron transport activity . N-terminal acetylation of the Rieske iron-sulfur protein (ISP) subunit is a unique aspect of the structure, resolved by mass spectrometry .

Role of Auxiliary Proteins: PetP

In cyanobacteria, PetP is a protein that regulates the balance between LET and CET . It interacts with the cytoplasmic side of cyt $$b_6f$$, displacing the C-terminus of the PetG subunit and shielding the C-terminus of cytochrome $$b_6$$, which binds the heme $$c_n$$ cofactor that is suggested to mediate CET .

Synechococcus elongatus PCC 7942 and Iron Starvation

Transcript profiling of Synechococcus elongatus PCC 7942 under iron (Fe) limitation reveals six regions on the chromosome with several Fe-regulated genes each . These regions include genes involved in Fe uptake systems (irpAB and fut), [Fe-sulfur] cluster assembly (suf), CP43' and flavodoxin (isiAB), electron transport associated protein IdiC and transcriptional activator IdiB (idiCB), and acetate kinase and phosphoglycerate mutase (ackA/ pgam) .

Recombinant Production

Recombinant full-length Synechococcus sp. Cytochrome $$b_6$$-f complex iron-sulfur subunit (petC) protein, His-tagged, is expressed in E. coli .

Siderophores and Iron Uptake

Siderophores, low molecular weight iron chelators secreted by microorganisms, have the potential to be natural iron fortifiers . Siderophores derived from Synechococcus sp. PCC7002 enhance iron absorption in polarized Caco-2 cell monolayers, with the main absorption site being the duodenum at pH 5.5 . The absorption methods include endocytosis and DMT1, with endocytosis being dominant .

Table: Hemoglobin (Hb) Concentration and Hematocrit (Hct) Levels in Iron-Deficient Rats After Iron Repletion

GroupInitial Hb (g/L)Final Hb (g/L)Hb change (g/L)Initial Hct (%)
Control162.25 ± 20.50 a166.25 ± 22.55 a4 ± 3.74 a45.65 ± 4.09 a
Fe-Deficient74.5 ± 13.48 b71.5 ± 20.97 b−3 ± 9.14 a15.9 ± 4.43 b
FeSO$$_4$$73.11 ± 14.24 b132.44 ± 16.99 c59.33 ± 5.27 b14 ± 3.32 b
SFC-Fe72.75 ± 12.73 b145.75 ± 16.51 c73 ± 5.89 c14.48 ± 3.55 b
Ferric Citrate71.75 ± 15.95 b113 ± 21.82 d41.25 ± 7.14 d15.35 ± 5.22 b

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please specify it at the time of order placement to facilitate preferential development.
Synonyms
petC; Synpcc7942_1232; Cytochrome b6-f complex iron-sulfur subunit; Plastohydroquinone:plastocyanin oxidoreductase iron-sulfur protein; ISP; RISP; Rieske iron-sulfur protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)
Target Names
petC
Target Protein Sequence
MTQVSGASDVPSMGRRQFMNLLTFGSVTGVALGALYPVVNYFIPPSSGGSGGGVAAKDAL GNDVVLSKFLADHNVGDRTLVQGLKGDPTYLVVESSEAIGDYGINAVCTHLGCVVPWNAS ENKFKCPCHGSQYDATGKVVRGPAPLSLALAHVSVTDDKVFLSPWTETDFRTGDNPWWA
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is the petC gene in Synechococcus elongatus and what role does its protein product play in photosynthesis?

The petC gene in Synechococcus elongatus encodes the iron-sulfur protein (ISP) subunit of the cytochrome b6f complex, which is a critical component of the photosynthetic electron transport chain. This complex mediates electron transfer coupled to proton translocation across the thylakoid membrane . The ISP contains a [2Fe-2S] cluster that accepts electrons from reduced plastoquinol (PQH2) and transfers them to cytochrome f, forming part of the high-potential electron transfer chain in photosynthesis . Through this function, the ISP plays an essential role in linking photosystem II and photosystem I during the light reactions of photosynthesis.

How is the cytochrome b6f complex structured in Synechococcus elongatus?

The cytochrome b6f complex in Synechococcus elongatus is organized as a dimer with a molecular weight of approximately 220,000 Da, containing 26 transmembrane helices . Each monomer consists of eight polypeptide subunits:

SubunitGeneCalculated Mass (Da)Measured Mass (Da)
Cytochrome fpetA32,27032,270
Cytochrome b6petB24,88424,710
Rieske iron-sulfur proteinpetC19,20219,295
Subunit IVpetD17,52217,528
PetGpetG-4,057
PetMpetM3,8423,841
PetLpetL3,5303,530
PetNpetN3,3043,304

The complex includes distinctive structural features such as a p-side binding niche for reduced plastoquinol (PQH2) and both high and low-potential electron transfer chains . The small subunits (PetG, PetL, PetM, and PetN) likely provide structural support arranged as a "picket fence" at the lateral boundary of the dimer .

What are the key functional domains of the iron-sulfur protein (ISP) encoded by petC?

The ISP encoded by petC contains several key functional domains:

  • A membrane-anchoring domain with a single transmembrane helix

  • A flexible "hinge" region of approximately 8 residues

  • An extrinsic domain containing the catalytic [2Fe-2S] cluster

The hinge region is particularly important as it allows for the large amplitude motion of the ISP extrinsic domain, which is critical for mediating electron transfer from plastoquinol to cytochrome f . This movement enables the ISP to interact alternately with the Qp site (where it receives electrons from plastoquinol) and cytochrome f (where it donates electrons).

What strategies exist for optimizing recombinant expression of the petC gene in Synechococcus elongatus?

Several strategies have been developed to optimize recombinant protein expression in Synechococcus elongatus, which can be applied to petC:

  • Codon optimization: Due to the high GC content of the S. elongatus genome (~55.5% GC), adapting the gene of interest to the preferred codon usage of highly expressed S. elongatus genes significantly improves expression levels .

  • Promoter selection: Using native promoters such as the psbA2 promoter, which responds to stress conditions, eliminates the need for costly exogenous inducers and reduces potential cell stress .

  • Advanced expression systems: The pET expression system adapted for cyanobacteria uses a dedicated T7 RNA polymerase for expression under the control of a nickel-inducible promoter, resulting in significantly higher expression levels compared to native systems .

  • Physical stimulation: Exposure to magnetic fields (30 mT) has been shown to increase gene transcription under the psbA2 promoter, providing a novel approach to enhancing recombinant protein production .

  • Integration site selection: Integration into neutral sites (NS1) that can be disrupted without any aberrant phenotype ensures stable expression without affecting essential cellular functions .

  • Vector optimization: Specialized vectors like the GeneArt Synechococcus Protein Expression Vector offer dual protein tags for detection and purification, enabling expression levels >10% of total soluble protein .

How do mutations in the hinge region of the iron-sulfur protein affect the functionality of the cytochrome b6f complex?

Surprisingly, mutagenesis-function analysis of the ISP hinge region in the cytochrome b6f complex of Synechococcus sp. PCC 7002 revealed remarkable functional resilience despite significant structural alterations. The complex maintained functionality despite changes that:

  • Increased hinge flexibility

  • Decreased flexibility through substitution of 4-6 proline residues

  • Shortened the hinge by a 1-residue deletion

  • Elongated the hinge by insertion of 4 residues

  • Elongation of the hinge by 4 residues increased sensitivity to Qp inhibitors

  • Deletion of 2 residues resulted in both decreased activity and loss of inhibitor sensitivity

These findings suggest a minimum hinge length of 7 residues is required for optimal binding of ISP at the Qp site. This functional insensitivity to structural changes stands in contrast to the cytochrome bc1 complex, where the hinge region is more sensitive to perturbations, highlighting an interesting evolutionary difference between these related complexes .

What are the differences in ISP structure and function between cyanobacterial cytochrome b6f and other photosynthetic organisms?

  • Inhibitor binding mechanism: Crystallography studies revealed distinct binding modes for the inhibitor tridecylstigmatellin (TDS). In algal (C. reinhardtii) b6f complexes, the TDS headgroup enters the Qp pocket and forms a hydrogen bond with His155 of the ISP. In contrast, in cyanobacterial b6f complexes, TDS exhibits a novel binding orientation where its hydrocarbon tail plugs the portal and its headgroup remains outside the Qp pocket .

  • Qp pocket architecture: The differences in inhibitor binding reflect underlying structural variations in the Qp pocket architecture between cyanobacterial and algal cytochrome b6f complexes .

  • Functional resilience: As noted above, the cyanobacterial cytochrome b6f complex demonstrates remarkable functional insensitivity to structural changes in the ISP hinge region, contrasting with the more structurally sensitive cytochrome bc1 complex .

These differences suggest evolutionary adaptations in different photosynthetic lineages while maintaining core electron transfer functionality.

What are the optimal vector systems for expressing recombinant petC in Synechococcus elongatus?

Based on the search results, several vector systems have been optimized for recombinant protein expression in Synechococcus elongatus:

  • GeneArt Synechococcus Protein Expression Vector: This specialized system features:

    • Two multiple cloning sites providing options for N- and C-terminal polyhistidine tags

    • A TEV recognition site for N-terminal tag removal after purification

    • The V5 epitope for detection with anti-V5 antibodies

    • Integration into a neutral site (NS1) via homologous recombination

    • Spectinomycin resistance for selection

  • pET system adapted for cyanobacteria: This system uses:

    • A dedicated T7 RNA polymerase for expression

    • A nickel-inducible promoter for controlled expression

    • Has demonstrated sevenfold higher expression than native systems

  • Shuttle expression vectors: These contain:

    • Antibiotic resistance (KmR)

    • The strong psbA promoter

    • Appropriate terminator regions

The transformation of S. elongatus relies on homologous recombination between the cell's chromosome and exogenous DNA containing sequences homologous to the chromosome. When transformed with vectors containing antibiotic resistance and neutral site sequences, a double homologous recombination event occurs, inserting the gene of interest into the genome while the vector backbone is lost .

How can researchers screen for successful integration of recombinant petC in Synechococcus elongatus?

The following protocol for screening successful integration is based on the methodology described in the search results:

  • Colony PCR preparation:

    • Streak or patch colonies onto fresh BG-11 agar plates containing the appropriate antibiotic (10 μg/mL spectinomycin or kanamycin)

    • Allow colonies to grow for 1-2 days until sufficient growth is observed

  • Colony PCR reaction setup:

    ReagentAmount
    AccuPrime Pfx SuperMix or PCR SuperMix High Fidelity45 μL
    Primer pre-mix (10 μM each of forward and reverse primers)1 μL
    Colony material (equivalent to about 1 small colony)-
  • PCR conditions:

    • Initial denaturation: 95°C for 5 minutes

    • Standard PCR cycling protocol (optimized for target gene)

    • Final extension and storage at 2-8°C

  • Analysis of integration:

    • Analyze PCR products by agarose gel electrophoresis

    • For complete integration confirmation, design primers that amplify across the integration junction

    • Expected product size will depend on the specific construct design

For example, in one study, integration was confirmed by "the amplification of a 1.8-kb fragment corresponding to the distance between the genomic locus Synpcc7942_0741 (Phage tail protein I gene) and the chloramphenicol resistance gene" .

What growth conditions are optimal for expressing recombinant proteins in Synechococcus elongatus?

The optimal growth conditions for Synechococcus elongatus expression of recombinant proteins include:

  • Media composition:

    • Gibco BG-11 medium specifically formulated for optimal growth and maintenance of S. elongatus cells

    • The 1X formulation avoids laborious media preparation steps and ensures consistency

  • Temperature:

    • Maintain cultures at 34°C ± 1°C for optimal growth

  • Atmosphere:

    • Supply 1-2% CO2 in air to support photosynthetic growth

  • Light conditions:

    • Continuous illumination is typically used

    • Light intensity should be optimized for specific experimental conditions

  • Culture vessels:

    • Use sterile containers that permit gas exchange

    • Maintain aseptic technique and work in a laminar flow hood

  • Antibiotic selection:

    • For recombinant strains, maintain selection with appropriate antibiotics:

      • 10 μg/mL spectinomycin for pSyn_6 vector transformants

      • Kanamycin for vectors using KmR resistance

One advantage of using S. elongatus as an expression system is its ability to utilize CO2 as a carbon source, potentially allowing integration with industrial processes like ethanol production where CO2 is a byproduct .

How can researchers assess proper folding and [2Fe-2S] cluster incorporation in recombinant ISP?

Assessment of proper folding and [2Fe-2S] cluster incorporation in recombinant ISP requires specialized techniques focusing on both structural and functional aspects:

Spectroscopic Methods:

  • UV-visible absorption spectroscopy: Properly assembled [2Fe-2S] clusters in the ISP exhibit characteristic absorption features that can be used to verify metal incorporation and monitor redox state changes.

  • Electron paramagnetic resonance (EPR): The reduced [2Fe-2S] cluster of the ISP exhibits distinctive EPR signals. The search results mention that EPR has been used to study the electronic structure of iron-sulfur clusters in cytochrome complexes .

  • Resonance Raman spectroscopy: This technique can provide detailed information about the vibrational modes of the [2Fe-2S] cluster and its coordination environment.

Functional Analyses:

  • Inhibitor binding studies: The search results describe how inhibitors like tridecylstigmatellin (TDS) interact with both the Qp site and the ISP. Proper binding of these inhibitors indicates correct folding and positioning of the ISP .

  • Redox potential measurements: Determining the midpoint oxidation-reduction potential (Em) of the [2Fe-2S] cluster can confirm proper incorporation and protein environment around the cluster.

  • Electron transfer assays: Measuring electron transfer rates from suitable donors to the ISP and from the ISP to cytochrome f can verify functional integrity.

Structural Verification:

  • Mass spectrometry: The search results mention that electrospray ionization mass spectrometry has been used to measure subunit masses of the cytochrome b6f complex, including the ISP (calculated: 19,202 Da, measured: 19,295 Da) . This approach can verify the intact mass of the recombinant protein.

What are the key considerations when designing functional assays for recombinant ISP?

When designing functional assays for recombinant ISP expressed in Synechococcus elongatus, researchers should consider:

  • Assay environment: The ISP functions within the membrane-bound cytochrome b6f complex, so assays should recreate appropriate conditions:

    • Consider using liposomes or nanodiscs to provide a membrane-like environment

    • Include appropriate detergents if working with solubilized proteins

    • Maintain physiologically relevant pH (typically 7-8 for cyanobacterial systems)

  • Redox partners: Select appropriate electron donors and acceptors:

    • For donor side: plastoquinol or suitable analogs

    • For acceptor side: cytochrome f or suitable electron acceptors

  • Detection methods:

    • Spectrophotometric assays monitoring absorbance changes during redox reactions

    • Oxygen consumption or evolution measurements

    • Artificial electron acceptors with easily measurable properties

  • Inhibitor sensitivity: The search results mention that mutations in the ISP hinge region affected sensitivity to Qp inhibitors . Using inhibitors like tridecylstigmatellin (TDS) can provide insights into functional integrity.

  • Controls:

    • Include wild-type ISP or whole cytochrome b6f complex as positive controls

    • Use heat-denatured protein as negative control

    • Include samples without key substrates or cofactors as baseline controls

  • Environmental variables: Test function across a range of conditions:

    • Temperature dependence (important for photosynthetic organisms that experience temperature fluctuations)

    • Salt concentration effects

    • Effects of physiologically relevant molecules

  • Data analysis: Determine appropriate kinetic parameters:

    • Initial rates under varying substrate concentrations

    • Inhibition constants with specific inhibitors

    • Comparison with published parameters for native ISP

How can researchers differentiate between native and recombinant ISP in Synechococcus elongatus?

Differentiating between native and recombinant ISP in Synechococcus elongatus can be accomplished through several complementary approaches:

  • Affinity tags: The GeneArt Synechococcus Protein Expression Vector system provides options for adding N- and/or C-terminal polyhistidine tags to the recombinant protein . These tags enable:

    • Specific detection using anti-His antibodies

    • Selective purification using immobilized metal affinity chromatography

    • Differentiation by size on SDS-PAGE or Western blots

  • Epitope tags: The V5 epitope tag available in the expression system allows specific detection of recombinant proteins using anti-V5 antibodies .

  • Mass determination: The search results show that electrospray ionization mass spectrometry can accurately measure protein masses . The additional mass from tags or other modifications allows differentiation between native and recombinant forms.

  • Genetic approaches: The search results mention that "of three petC genes, only that in the petCA operon codes for functional ISP" in Synechococcus . Researchers could potentially:

    • Express recombinant ISP in neutral sites while the native gene remains in its original location

    • Create knockout strains of the native functional petC combined with recombinant expression

  • Expression control: Using inducible systems like the nickel-inducible promoter mentioned in the search results allows researchers to compare samples with and without induction .

  • Functional properties: If the recombinant ISP contains specific mutations or modifications, it may exhibit altered:

    • Inhibitor sensitivity (as observed with hinge region mutations)

    • Redox potential

    • Spectroscopic properties

What are common pitfalls in the heterologous expression of petC in Synechococcus elongatus?

Several common pitfalls can impede successful heterologous expression of petC in Synechococcus elongatus:

  • Non-optimized codon usage: The S. elongatus genome has a high GC content (~55.5%), with specific patterns at each codon position (1st letter GC ~64%, 2nd letter GC ~44%, 3rd letter GC ~60%) . Failure to adapt the petC sequence to these preferences can significantly reduce expression.

  • Incomplete integration verification: The search results emphasize the importance of screening "for integration by colony PCR" to confirm proper incorporation of the expression construct . False positives may occur if verification is inadequate.

  • Multiple gene copies interference: The search results note that "of three petC genes, only that in the petCA operon codes for functional ISP" . Recombinant petC expression may face competition or interference from native copies.

  • Improper [2Fe-2S] cluster assembly: As a metalloprotein containing a [2Fe-2S] cluster, proper folding and metal center assembly is crucial for ISP function but may be challenging in heterologous expression.

  • Membrane integration issues: The ISP contains a transmembrane domain, and improper membrane targeting or integration can compromise function.

  • Insufficient selection pressure: Maintaining appropriate antibiotic selection (spectinomycin or kanamycin) is necessary but must be balanced against causing excessive stress to the cells .

  • Suboptimal growth conditions: S. elongatus requires specific growth conditions (34°C ± 1°C with 1-2% CO2 in air) for optimal protein expression .

  • Protein toxicity: Overexpression of membrane proteins or proteins that interact with essential complexes may disrupt cellular function and result in growth defects or selection against high-expressing cells.

How can researchers address issues with low expression yields of recombinant ISP?

Based on the search results, researchers can implement several strategies to address low expression yields of recombinant ISP in Synechococcus elongatus:

  • Codon optimization: Adapt the petC gene to "the preferred codon usage of highly expressed Synechococcus elongatus PCC 7942 genes" using services like "Invitrogen GeneArt Gene Synthesis" .

  • Promoter optimization: Test different promoters that have shown success in cyanobacterial expression:

    • The psbA2 promoter, which responds to stress conditions

    • The T7 system with a dedicated RNA polymerase under nickel-inducible control

    • The strong constitutive PpsbA promoter

  • Physical stimulation: Apply magnetic fields (30 mT) during culture, which has been shown to increase transcription under the psbA2 promoter .

  • Expression vector optimization: Use specialized vectors like the GeneArt Synechococcus Protein Expression Vector designed to achieve ">10% total soluble protein from your gene of interest" .

  • Growth media optimization: Use "Gibco BG-11 Medium, offered separately, is optimized for the growth and maintenance of select cyanobacteria including S. elongatus" .

  • Integration site selection: Ensure integration at appropriate neutral sites that "can be disrupted without any aberrant phenotype" .

  • Culture condition optimization: Maintain optimal growth conditions (34°C ± 1°C with 1-2% CO2 in air) .

  • Expression timing: For inducible systems, optimize the timing of induction relative to growth phase for maximum yield.

  • Fusion partners: Consider adding fusion partners that may enhance stability or expression, utilizing the "two multiple cloning sites (MCS), which provide the option of adding N- and C-terminal polyhistidine tags to your recombinant fusion protein in any combination" .

One study demonstrated that implementing optimized expression systems resulted in "β-glucosidase activity more than sevenfold higher in the transformed cyanobacteria than in the wild-type strain" , suggesting significant improvements are possible with proper optimization.

What emerging technologies might enhance recombinant ISP research in Synechococcus elongatus?

Several emerging technologies show promise for advancing recombinant ISP research in Synechococcus elongatus:

  • CRISPR-Cas9 genome editing: While not explicitly mentioned in the search results, CRISPR technology could potentially:

    • Enable precise modification of native petC genes

    • Create clean knockouts of native ISP while expressing recombinant variants

    • Introduce site-specific mutations for structure-function studies

  • Synthetic biology approaches: The search results mention that S. elongatus "is an excellent synthetic biology chassis" , suggesting opportunities for:

    • Designing synthetic operons for coordinated expression of entire protein complexes

    • Engineering regulatory circuits for controlled expression

    • Creating minimal genomes with reduced interference from native systems

  • Advanced biophysical techniques: New methods for studying membrane proteins could enhance ISP characterization:

    • Cryo-electron microscopy for structural studies

    • Advanced spectroscopy for tracking electron transfer events

    • Single-molecule techniques for dynamic studies

  • Novel induction systems: Beyond the nickel-inducible system mentioned , developing:

    • Optogenetic control systems for light-regulated expression

    • Metabolite-responsive promoters for environmentally triggered expression

  • Integrated bioproduction: The search results mention that photosynthetic bioreactors using cyanobacteria can "not only produce cellulases at a lower cost, but also reduce the environmental impact caused by residues of 1G ethanol production" . Similar approaches could integrate ISP research with:

    • Carbon capture technologies

    • Biofuel production systems

    • Biosensor development

  • Physical stimulation methods: The finding that magnetic field application enhances protein expression suggests other physical methods might be developed to improve yields or manipulate protein properties.

What unresolved questions remain about the structure-function relationship of the ISP in Synechococcus elongatus?

Despite significant advances, several important questions about the ISP structure-function relationship in Synechococcus elongatus remain unresolved:

  • Functional insensitivity mechanism: The search results reveal that the cytochrome b6f complex demonstrates "functional insensitivity" to structural changes in the ISP hinge region , but the molecular basis for this insensitivity compared to the more structurally sensitive cytochrome bc1 complex remains unclear.

  • Species-specific inhibitor binding: The search results describe different binding modes for the inhibitor TDS in cyanobacterial versus algal cytochrome b6f complexes . The evolutionary and functional significance of these differences warrants further investigation.

  • Dynamic behavior during electron transfer: While the search results mention "a large amplitude motion of the Rieske iron-sulfur protein (ISP) is required to mediate electron transfer" , the precise dynamics, timing, and potential regulation of this motion in living cells remain to be fully characterized.

  • Multiple petC genes: The search results note that "of three petC genes, only that in the petCA operon codes for functional ISP" . The evolutionary retention and potential functions of the apparently non-functional petC genes remain to be elucidated.

  • Optimum expression conditions: While strategies for recombinant expression have been developed, the ideal combination of promoters, codon optimization, and culture conditions specifically for petC expression requires further optimization.

  • Integration with other photosynthetic complexes: The detailed interactions between the cytochrome b6f complex and other components of the photosynthetic apparatus in Synechococcus elongatus, including potential supercomplex formation, remain areas for further research.

  • Post-translational modifications: The potential role of post-translational modifications in regulating ISP function in Synechococcus elongatus remains largely unexplored.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.