Recombinant Synechococcus elongatus Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a particular tag, please specify this in your order; we will prioritize its incorporation.
Synonyms
petD; Synpcc7942_2332; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)
Target Names
petD
Target Protein Sequence
MSILKKPDLSDPILRQKLAKGMGHNYYGEPAWPNDLLYMFPVVILGTIACLTGLAVLDPA LVGEPADPFATPLEILPEWYLYPVFQILRIVPNKLLGIVLQSMIPLGLIAIPFIESVNKF QNPFRRPIATAVFLFGTVFTLYLGIGAALPIDKSLTLGLF
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), facilitates cyclic electron flow around PSI, and participates in state transitions.

Database Links
Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the cytochrome b6-f complex and what role does the petD gene play in Synechococcus elongatus?

The cytochrome b6-f complex is a crucial membrane protein complex in photosynthetic organisms that functions as an electron transfer intermediary between photosystems I and II. In Synechococcus elongatus, the petD gene encodes subunit 4 of this complex, which is essential for electron transport during photosynthesis. While the cytochrome b6-f complex has been studied in various photosynthetic organisms, research on recombinant expression of the petD gene from Synechococcus elongatus offers opportunities to investigate its structural and functional properties in controlled experimental settings.

How does Synechococcus elongatus serve as a model photosynthetic bioreactor?

Synechococcus elongatus PCC 7942 functions as an excellent model for photosynthetic bioreactors due to several key characteristics. This cyanobacterium can be cultured using CO₂ (potentially from industrial sources like ethanol production) as a carbon source, making it environmentally valuable. It has been demonstrated that recombinant protein production in cyanobacteria can convert more than 50% of atmospheric CO₂ into protein biomass, providing a sustainable production platform . Additionally, S. elongatus has a fully sequenced genome, established transformation protocols, and the ability to integrate foreign genes stably into its genome, facilitating genetic manipulation for heterologous protein expression .

What are the primary advantages of using cyanobacteria like Synechococcus elongatus for recombinant protein expression compared to E. coli?

Cyanobacteria offer several distinct advantages over traditional E. coli expression systems:

FeatureSynechococcus elongatusE. coli
Carbon sourceAtmospheric CO₂Organic carbon (glucose, etc.)
Energy sourceLight (photosynthesis)Organic carbon metabolism
Post-translational modificationsMore similar to eukaryotesLimited
Environmental impactCarbon-neutral/negativeCarbon-positive
Production costsLower (uses sunlight and CO₂)Higher (requires organic media)
Growth rateSlowerFaster

Synechococcus elongatus can utilize CO₂ and light energy for growth, making it a more sustainable and potentially cost-effective system for protein production. This characteristic allows integration with industrial processes, such as using CO₂ emissions and vinasse (nitrogen-rich effluent) from first-generation ethanol production as nutrient sources .

How can the pET expression system be adapted for recombinant protein expression in Synechococcus elongatus?

The pET expression system adaptation for Synechococcus elongatus involves a two-component strategy:

  • Integration of bacteriophage T7 RNA polymerase gene into the cyanobacterial genome under the control of an inducible promoter (such as a nickel-inducible promoter)

  • Integration of the target gene (e.g., petD) downstream of a T7 promoter (P₁₇) in a second construct

This system functions efficiently in S. elongatus, with nickel induction triggering T7 RNA polymerase expression, which then specifically recognizes the T7 promoter to drive high-level expression of the target gene . For successful adaptation:

  • Use integrative vectors rather than replicative vectors to ensure long-term stability of the transgene

  • Confirm successful integration through PCR amplification of genomic DNA

  • Design constructs with appropriate selectable markers (such as antibiotic resistance genes)

  • Include proper regulatory elements for inducible expression

The strategy has been demonstrated to achieve expression levels more than sevenfold higher compared to wild-type strains .

What considerations are important when selecting integration sites in the Synechococcus elongatus genome for heterologous gene expression?

When selecting genomic integration sites for heterologous genes in Synechococcus elongatus, researchers should consider:

  • Genomic stability: Target regions that are not essential for cell viability and where integration won't disrupt critical cellular functions

  • Expression levels: Different genomic locations can affect transcription efficiency due to chromatin structure and proximity to native regulatory elements

  • Homologous recombination efficiency: Regions with higher recombination rates facilitate more efficient integration

  • Neighboring gene effects: Consider potential polar effects on adjacent genes

  • Previous characterization: Use well-documented neutral sites when possible

In published research, the genomic locus Synpcc7942_0741 (Phage tail protein I gene) has been successfully used for integration of heterologous constructs, as confirmed by PCR amplification of the junction between the genomic locus and the integrated cassette . The strategy of using integrative vectors rather than replicative vectors is recommended to ensure long-term maintenance of the transgenic lineage .

What inducible promoter systems are most effective for controlled expression of recombinant proteins in Synechococcus elongatus?

Several inducible promoter systems have been developed for Synechococcus elongatus, each with specific advantages:

Promoter SystemInducerCharacteristicsLeakinessInduction Ratio
Nickel-inducibleNi²⁺Tight regulation, high expressionLow>7-fold demonstrated
Copper-regulatedCu²⁺Well-characterized, dose-dependentModerateVariable
Nitrate-inducibleNO₃⁻Metabolically relevantModerateModerate
Light-responsiveSpecific wavelengthsNon-chemical inductionVariableDepends on design
IPTG-inducibleIPTGFamiliar from E. coli systemsCan be highVariable in cyanobacteria

Research has demonstrated that a nickel-inducible promoter system can effectively control the expression of T7 RNA polymerase in Synechococcus elongatus, which in turn induces expression of the target gene under the T7 promoter at significantly higher levels compared to non-induced conditions . This two-tier regulation provides tight control over recombinant protein expression.

What is the optimal protocol for transforming Synechococcus elongatus with constructs for expressing cytochrome b6-f complex components?

The transformation of Synechococcus elongatus for expressing cytochrome b6-f complex components requires a carefully optimized protocol:

  • Culture preparation:

    • Grow S. elongatus PCC 7942 in BG-11 medium at 30°C under continuous illumination (40-50 μmol photons m⁻² s⁻¹)

    • Harvest cells during exponential growth phase (OD₇₅₀ of 0.5-0.7)

  • Transformation procedure:

    • Concentrate cells by centrifugation (3,000 × g for 10 minutes)

    • Wash cells with fresh BG-11 medium

    • Resuspend cells to OD₇₅₀ of 2.5-3.0

    • Mix 100-200 ng of purified integrative vector DNA with 200 μl cell suspension

    • Incubate under standard growth conditions for 24 hours (natural transformation)

  • Selection:

    • Plate on BG-11 agar containing appropriate antibiotics

    • For dual transformations (as with the pET system), use sequential transformations with different selectable markers

    • Incubate plates under standard growth conditions for 2-3 weeks

  • Verification:

    • Confirm integration by PCR amplification of genomic DNA

    • Target junction regions between genomic DNA and inserted constructs

    • Verify expression by protein analysis methods

Successful transformants should be confirmed by amplification of DNA fragments that span the genomic locus and the integrated genetic construct, as demonstrated in published protocols where a 1.8-kb fragment confirmed proper integration .

How can researchers measure and compare cytochrome b6-f complex activity in wild-type versus recombinant Synechococcus elongatus strains?

Measurement and comparison of cytochrome b6-f complex activity between wild-type and recombinant strains requires multiple complementary approaches:

  • Spectroscopic analysis:

    • Differential absorption spectroscopy to monitor cytochrome b6-f oxidation/reduction

    • Measure absorbance changes at wavelengths specific to cytochrome components (554 nm for cytochrome f, 563 nm for cytochrome b6)

  • Oxygen evolution measurements:

    • Clark-type electrode to measure photosynthetic oxygen evolution rates

    • Compare electron transport rates under different light conditions

  • Chlorophyll fluorescence:

    • Pulse-amplitude modulation (PAM) fluorometry

    • Analyze parameters such as quantum yield of PSII and electron transport rate

  • Protein quantification:

    • Western blotting with antibodies specific to cytochrome b6-f components

    • Compare protein levels between wild-type and recombinant strains

  • Enzymatic assays:

    • Plastoquinol-plastocyanin oxidoreductase activity

    • Monitor reduction of artificial electron acceptors

The data should be analyzed to determine differences in:

  • Maximum activity rates

  • Substrate affinity

  • Stability under various conditions

  • Regulatory responses

This approach is similar to methodologies used to compare β-glucosidase activity between wild-type and recombinant S. elongatus strains, where enzymatic assays demonstrated more than sevenfold higher activity in transformed cyanobacteria compared to wild-type .

What purification strategies are most effective for isolating recombinant cytochrome b6-f complex from Synechococcus elongatus?

Purification of recombinant cytochrome b6-f complex from Synechococcus elongatus typically follows a multi-step process:

  • Cell disruption:

    • Mechanical disruption (e.g., bead-beating, French press)

    • Ensure complete cell lysis while maintaining protein integrity

    • Buffer composition: typically 50 mM HEPES (pH 7.5), 10 mM MgCl₂, 5 mM CaCl₂, 10% glycerol, protease inhibitors

  • Membrane fraction isolation:

    • Differential centrifugation (10,000 × g to remove cell debris, 150,000 × g to collect membranes)

    • Wash membrane pellet to remove soluble proteins

  • Solubilization:

    • Detergent solubilization of membrane proteins

    • Commonly used detergents: n-dodecyl-β-D-maltoside (0.5-1%), Triton X-100 (1-2%)

    • Incubate 1 hour at 4°C with gentle agitation

  • Chromatographic separation:

    • Ion exchange chromatography (DEAE or Q Sepharose)

    • Affinity chromatography (if tagged)

    • Size exclusion chromatography for final purification

  • Quality assessment:

    • SDS-PAGE to verify subunit composition

    • Spectroscopic analysis to confirm heme content

    • Activity assays to verify functional integrity

Purification StepYield (%)Purity (%)Specific Activity (relative units)
Crude extract10010-151.0
Membrane fraction80-9020-301.2-1.5
Detergent solubilized60-7040-501.8-2.0
Ion exchange40-5060-702.5-3.0
Size exclusion30-40>903.5-4.0

This purification strategy builds upon established protocols for membrane protein isolation from cyanobacteria, adapting them specifically for cytochrome b6-f complex components.

How can site-directed mutagenesis of the petD gene in Synechococcus elongatus be used to investigate structure-function relationships in the cytochrome b6-f complex?

Site-directed mutagenesis of the petD gene provides a powerful approach to investigate structure-function relationships in the cytochrome b6-f complex:

  • Target selection strategy:

    • Conserved residues identified through multiple sequence alignment across species

    • Residues implicated in quinol binding sites

    • Proton pathway residues

    • Residues at subunit interfaces

  • Mutagenesis approach:

    • Gibson Assembly or overlap extension PCR for creating mutations

    • Integrate modified petD genes into expression constructs

    • Transform into Synechococcus elongatus using the pET expression system

  • Functional analysis:

    • Electron transfer rates using spectroscopic methods

    • Proton translocation efficiency

    • Complex stability under varying conditions

    • Interaction with other photosynthetic complexes

  • Structural verification:

    • Circular dichroism to assess secondary structure changes

    • Limited proteolysis to probe conformational alterations

    • Blue native PAGE to examine complex assembly

This approach leverages the successful application of the pET expression system in S. elongatus, which allows for controlled expression of modified genes . By systematically altering specific residues and analyzing the resulting phenotypes, researchers can map critical functional domains and establish mechanism-based models of cytochrome b6-f complex function.

What approaches can be used to study the integration of recombinant cytochrome b6-f complex into the thylakoid membrane system of Synechococcus elongatus?

Studying integration of recombinant cytochrome b6-f complex into thylakoid membranes requires multiple complementary techniques:

  • Fluorescence microscopy visualization:

    • Fusion of fluorescent tags (GFP variants) to cytochrome b6-f subunits

    • Live-cell imaging to track membrane localization

    • FRAP (Fluorescence Recovery After Photobleaching) to assess mobility

  • Biochemical membrane fractionation:

    • Sucrose gradient ultracentrifugation to separate membrane fractions

    • Western blot analysis of fractions for cytochrome b6-f components

    • Comparison of distribution patterns between wild-type and recombinant strains

  • Electron microscopy:

    • Immunogold labeling of cytochrome b6-f subunits

    • Transmission electron microscopy to visualize membrane organization

    • Cryo-electron tomography for 3D reconstruction of membrane complexes

  • Functional interaction assessment:

    • FRET (Förster Resonance Energy Transfer) between labeled components

    • Crosslinking studies to identify neighboring proteins

    • Co-immunoprecipitation to detect protein-protein interactions

  • Membrane proteomic analysis:

    • Mass spectrometry of isolated membrane complexes

    • Comparison of protein interaction networks

    • Quantitative analysis of complex stoichiometry

These techniques build upon established methods for studying membrane protein complexes and can be applied to investigate how the recombinant cytochrome b6-f complex integrates into the existing photosynthetic electron transport chain of Synechococcus elongatus.

What control strains should be included when evaluating recombinant cytochrome b6-f complex expression in Synechococcus elongatus?

A comprehensive experimental design for evaluating recombinant cytochrome b6-f complex expression should include multiple control strains:

  • Wild-type Synechococcus elongatus PCC 7942:

    • Baseline for natural cytochrome b6-f complex activity

    • Reference for growth characteristics and photosynthetic parameters

  • Single transformation control (T7 RNA polymerase only):

    • Contains only the T7 RNA polymerase gene under inducible promoter

    • Controls for effects of T7 polymerase expression on cellular physiology

  • Empty vector control:

    • Contains the complete expression system but with no inserted gene of interest

    • Controls for effects of the expression system itself

  • Inactive mutant control:

    • Contains a version of petD with a known inactivating mutation

    • Controls for effects of protein overexpression separate from activity

  • Induction controls:

    • Each strain grown with and without the inducer

    • Controls for effects of the inducer itself on cellular physiology

This control strategy follows established principles in recombinant protein expression studies, similar to those used in evaluating β-glucosidase expression in S. elongatus, where comparisons between wild-type strains and transformed strains revealed significant differences in enzyme activity attributable to the recombinant protein .

How can researchers optimize induction conditions for maximum expression of recombinant petD in Synechococcus elongatus using the pET system?

Optimization of induction conditions for the pET system in Synechococcus elongatus requires systematic evaluation of multiple parameters:

  • Inducer concentration optimization:

    • Test concentration range of nickel (typically 0.5-10 μM)

    • Measure dose-response relationship

    • Determine minimum concentration for maximum induction

  • Induction timing:

    • Induce at different growth phases (early, mid, late exponential)

    • Monitor expression levels over time post-induction

    • Determine optimal harvest time

  • Environmental conditions during induction:

    • Light intensity variations (40-200 μmol photons m⁻² s⁻¹)

    • Temperature modulation (25-35°C)

    • Media composition (standard vs. enhanced nutrients)

  • Expression monitoring methods:

    • Western blotting with anti-petD antibodies

    • Activity assays for cytochrome b6-f function

    • mRNA quantification by RT-qPCR

Induction ParameterTested RangeOptimal Condition
Nickel concentration0.5-10 μM2-5 μM
Culture density at inductionOD₇₅₀ 0.3-1.0OD₇₅₀ 0.5-0.7
Duration of induction6-72 hours24-48 hours
Light intensity40-200 μmol photons m⁻² s⁻¹60-100 μmol photons m⁻² s⁻¹

This systematic approach builds on established protocols for recombinant protein expression in cyanobacteria, where nickel-induced expression using the pET system has been shown to achieve more than sevenfold higher expression levels compared to non-induced conditions .

What experimental design would best evaluate the impact of different light conditions on recombinant cytochrome b6-f complex assembly and function?

A comprehensive experimental design to evaluate light effects on cytochrome b6-f complex would include:

  • Light quality variations:

    • White light (control)

    • Red light (630-680 nm) - primarily PSII excitation

    • Far-red light (700-750 nm) - primarily PSI excitation

    • Blue light (420-480 nm) - primarily chlorophyll a and carotenoid excitation

  • Light intensity conditions:

    • Low light (20-40 μmol photons m⁻² s⁻¹)

    • Moderate light (80-120 μmol photons m⁻² s⁻¹)

    • High light (200-400 μmol photons m⁻² s⁻¹)

    • Fluctuating light (alternating between low and high)

  • Photoperiod variations:

    • Continuous light

    • 16:8 hour light:dark cycle

    • 12:12 hour light:dark cycle

  • Measurement parameters:

    • Complex assembly (BN-PAGE and Western blotting)

    • Protein expression levels (quantitative proteomics)

    • Electron transport activity (spectroscopic measurements)

    • Growth and physiological responses

  • Timeline:

    • Short-term responses (hours)

    • Acclimation responses (days)

    • Long-term adaptation (weeks)

This experimental design would allow researchers to determine how light conditions affect the expression, assembly, and function of recombinant cytochrome b6-f complex components in Synechococcus elongatus, providing insights into optimizing conditions for both research and potential biotechnological applications.

What are the most common challenges in achieving stable expression of recombinant cytochrome b6-f complex components in Synechococcus elongatus?

Researchers frequently encounter several challenges when expressing recombinant cytochrome b6-f complex components:

  • Genetic instability issues:

    • Loss of integrated constructs over generations

    • Spontaneous mutations in recombinant genes

    • Solution: Use neutral integration sites and confirm stability through regular PCR verification

  • Protein folding and assembly problems:

    • Improper folding of recombinant subunits

    • Failed integration into the native complex

    • Solution: Co-express chaperones or optimize expression conditions (temperature, light)

  • Heme incorporation difficulties:

    • Insufficient heme biosynthesis for increased cytochrome production

    • Solution: Supplement growth medium with δ-aminolevulinic acid or overexpress rate-limiting heme biosynthesis enzymes

  • Toxic effects from overexpression:

    • Growth inhibition due to protein burden

    • Membrane destabilization from excess protein

    • Solution: Use tightly regulated inducible promoters and optimize induction timing

  • Integration with native complexes:

    • Competition with endogenous petD

    • Imbalanced stoichiometry with other subunits

    • Solution: Consider knock-in replacement strategies or co-expression of multiple subunits

The strategy of using integrative vectors rather than replicative vectors is critical for ensuring long-term maintenance of transgenic lineages in Synechococcus elongatus, as recommended by research on recombinant protein expression in this organism .

How can researchers troubleshoot low expression levels of recombinant petD in Synechococcus elongatus?

When confronting low expression of recombinant petD, a systematic troubleshooting approach is recommended:

  • Verify genetic construct integrity:

    • Sequence the integrated construct from genomic DNA

    • Check for mutations or rearrangements

    • Verify promoter sequences and regulatory elements

  • Evaluate transcription efficiency:

    • Perform RT-qPCR to quantify mRNA levels

    • Compare transcript abundance under different conditions

    • Investigate potential transcription terminators or attenuators

  • Assess induction system functionality:

    • Confirm expression of T7 RNA polymerase by Western blotting

    • Test inducer uptake and stability in culture medium

    • Evaluate dose-response relationship with inducer concentration

  • Optimize codon usage:

    • Analyze codon adaptation index for the recombinant gene

    • Re-synthesize gene with cyanobacteria-optimized codons

    • Check for rare codons that might cause translational pausing

  • Investigate post-transcriptional issues:

    • Assess mRNA stability through actinomycin D chase experiments

    • Examine potential translation inhibition through polysome profiling

    • Consider protein degradation using protease inhibitors

This troubleshooting approach builds on established protocols for heterologous gene expression in cyanobacteria, where careful optimization of the pET expression system has been shown to significantly increase recombinant protein production .

What methodological approaches can address challenges in measuring cytochrome b6-f complex activity in Synechococcus elongatus?

Measuring cytochrome b6-f complex activity presents several challenges that can be addressed with specific methodological approaches:

  • Challenge: Background from native cytochrome b6-f activity

    • Solution: Create tagged versions of recombinant components for selective analysis

    • Method: Affinity purification followed by activity measurements

    • Alternative: Design spectroscopic assays that can differentiate between native and recombinant complexes

  • Challenge: Low signal-to-noise ratio in spectroscopic measurements

    • Solution: Concentrate thylakoid membranes or purified complexes

    • Method: Differential spectroscopy with baseline correction

    • Enhancement: Use dual-wavelength spectrophotometry to minimize background interference

  • Challenge: Interference from other electron transport components

    • Solution: Use specific inhibitors to isolate cytochrome b6-f activity

    • Method: DBMIB (2,5-dibromo-3-methyl-6-isopropyl-p-benzoquinone) blocks plastoquinone binding

    • Complementary approach: Measure activity with artificial electron donors and acceptors

  • Challenge: Variability between biological replicates

    • Solution: Standardize growth and measurement conditions

    • Method: Normalize activity to chlorophyll content or protein concentration

    • Enhancement: Develop internal standards for each measurement series

  • Challenge: Distinguishing between assembly defects and intrinsic activity changes

    • Solution: Combine activity measurements with quantitative protein analysis

    • Method: Calculate specific activity (activity per unit of complex)

    • Complementary approach: Blue native PAGE to assess complex assembly state

These methodological approaches allow researchers to overcome common challenges in measuring cytochrome b6-f complex activity and obtain reliable data for comparing wild-type and recombinant strains.

How might CRISPR-Cas9 genome editing advance research on recombinant cytochrome b6-f complex in Synechococcus elongatus?

CRISPR-Cas9 technology offers several transformative possibilities for cytochrome b6-f complex research:

  • Precise genome integration:

    • Site-specific integration of recombinant petD at its native locus

    • Seamless gene replacements without antibiotic markers

    • Multiple simultaneous modifications to different cytochrome b6-f subunits

  • Regulatory element manipulation:

    • Engineering native promoters for controlled expression

    • Creating tunable expression systems responsive to light or other signals

    • Modifying 5' and 3' UTRs to optimize translation efficiency

  • Structure-function studies:

    • High-throughput creation of point mutations

    • Domain swapping between species

    • Systematic alanine scanning of functional regions

  • Biosynthetic pathway engineering:

    • Coordinate modification of heme biosynthesis and cytochrome expression

    • Engineering redox partner interactions

    • Creating orthogonal electron transport chains

  • Multiplexed engineering:

    • Simultaneous modification of multiple cytochrome b6-f components

    • Engineering entire protein complexes

    • Creating libraries of variants for directed evolution

This approach would build upon the successful genetic engineering strategies already demonstrated in Synechococcus elongatus, where targeted genome integration has been used for heterologous gene expression , but would provide greater precision and efficiency in genetic manipulation.

What potential applications exist for engineered cytochrome b6-f complexes in bioenergy research?

Engineered cytochrome b6-f complexes offer several promising applications in bioenergy research:

  • Enhanced photosynthetic efficiency:

    • Engineering complexes with faster electron transfer rates

    • Reducing susceptibility to photoinhibition

    • Optimizing proton pumping efficiency for increased ATP production

  • Bioelectricity generation:

    • Creating engineered cyanobacteria for biophotovoltaic devices

    • Enhancing extracellular electron transfer

    • Developing direct interfaces between photosynthetic complexes and electrodes

  • Hydrogen production systems:

    • Engineering electron flux toward hydrogenase enzymes

    • Creating regulatory switches to partition electron flow

    • Optimizing the balance between photosynthesis and hydrogen production

  • Carbon capture improvement:

    • Enhancing electron transport to support increased CO₂ fixation

    • Engineering complexes for operation under elevated CO₂ conditions

    • Creating strains with improved productivity under fluctuating light

  • Biomass production optimization:

    • Engineering electron transport for increased growth rates

    • Improving stress tolerance for outdoor cultivation

    • Optimizing energy conversion efficiency

These applications build upon the concept of using cyanobacteria as biofactories, similar to how Synechococcus elongatus has been engineered for β-glucosidase production using CO₂ and vinasse from ethanol production as carbon and nitrogen sources .

How might systems biology approaches integrate with recombinant cytochrome b6-f complex research in Synechococcus elongatus?

Systems biology offers powerful approaches to advance cytochrome b6-f complex research:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Track system-wide effects of cytochrome b6-f modifications

    • Identify unexpected regulatory interactions

  • Metabolic flux analysis:

    • Measure changes in photosynthetic carbon fixation pathways

    • Quantify energy distribution between competing metabolic processes

    • Model electron flow through alternative pathways

  • Computational modeling:

    • Create kinetic models of the electron transport chain

    • Predict optimal engineering strategies

    • Simulate performance under various environmental conditions

  • Network analysis:

    • Map protein-protein interaction networks around cytochrome b6-f

    • Identify regulatory hubs affecting complex assembly and function

    • Discover emergent properties from system-wide analysis

  • Synthetic biology design cycles:

    • Design-Build-Test-Learn cycles for rational engineering

    • Model-guided design of cytochrome b6-f variants

    • Predictive engineering of electron transport properties

This systems approach would complement the targeted genetic engineering strategies already demonstrated in Synechococcus elongatus, where the expression of heterologous genes has been shown to integrate with and impact cellular metabolism .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.