Recombinant Synechococcus elongatus Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Genetic and Functional Context of Cytochrome b6 (petB)

The petB gene in Synechococcus elongatus (strain PCC 7942) is located in a two-operon system alongside petD (encoding subunit IV) within the cytochrome b6f complex . This cluster is distinct from the petC/petA operon (encoding the Rieske FeS-protein and cytochrome f, respectively) . The cytochrome b6f complex is integral to photosynthetic electron transport, linking PSII and PSI by mediating plastoquinol oxidation and plastocyanin reduction.

Key genetic features:

  • Locus name: Synpcc7942_2331

  • UniProt ID: Q54711

  • Protein length: 215 amino acids (full-length recombinant form)

Research Applications

Recombinant Cytochrome b6 is widely used in:

  1. Enzyme kinetics studies: Investigating electron transport efficiency under varying pH and redox conditions.

  2. Antibody development: Serves as an antigen for generating species-specific antibodies .

  3. Structural biology: Crystallization trials to resolve mechanisms of quinone-proton coupling .

Comparative Analysis with Homologs

FeatureSynechococcus elongatus (Q54711)Synechococcus sp. (Q7U4U6) Synechocystis sp. PCC 6803
Length215 aa218 aa214 aa
Operon organizationpetB/petDNot specifiedpetB/petD
Tagged variants availableHis-tag His-tag None reported

Challenges in Recombinant Expression

  • Solubility: Membrane-associated nature necessitates detergent use during purification .

  • Stability: Requires glycerol-supplemented buffers to prevent aggregation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request accordingly.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us. We will prioritize development of the specified tag.
Synonyms
petB; Synpcc7942_2331; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)
Target Names
petB
Target Protein Sequence
MSKVYDWFEERLEIQAIAEDVSSKYVPPHVNIFYCLGGITLTCFLIQFATGFAMTFYYKP TVAEAYSSVQFIMNQVNFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKRPRELTWVT GVVMAVITVTFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGSAMVELLRGGQSVGQATL TRFYSLHTFVLPWLIAVFMLLHFLMIRKQGISGPL
Uniprot No.

Target Background

Function
Cytochrome b6 is a component of the cytochrome b6-f complex, which plays a crucial role in mediating electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Synechococcus elongatus and why is it an important model organism for photosynthesis research?

Synechococcus elongatus is a photosynthetic cyanobacterium that has emerged as a valuable model organism for studying photosynthesis and metabolic engineering. This unicellular organism utilizes complex antenna systems called phycobilisomes to efficiently harvest available light for photosynthesis . S. elongatus possesses several characteristics that make it particularly attractive for research, including its relatively simple genetic makeup, natural transformation capability, and fully sequenced genome. The organism has become especially relevant as a photosynthetic bioreactor due to its ability to utilize CO₂ as a carbon source, potentially integrating with first-generation ethanol production by using CO₂ emissions and vinasse (an ethanol production effluent) as nitrogen sources . This feature makes S. elongatus not only valuable for fundamental photosynthesis research but also for sustainable biotechnology applications aimed at reducing environmental impacts of biofuel production.

How is the Cytochrome b6/f complex assembled in cyanobacteria?

The assembly of the Cytochrome b6/f complex in cyanobacteria involves a coordinated process of protein synthesis, cofactor attachment, and subunit assembly. The complex consists of multiple subunits including Cytochrome b6, Cytochrome f, and several smaller subunits that must be correctly assembled for proper function. A critical step in this assembly is the covalent attachment of heme groups to the cytochrome subunits . For Cytochrome b6, this involves the CCB (cytochrome c biogenesis) pathway, which is responsible for the covalent binding of heme c(i) to Cytochrome b6 on the stromal side of the thylakoid membranes . Research has shown that defects in the CCB pathway lead to reduced accumulation of subunits of the Cytochrome b6/f complex and improper covalent binding of heme to Cytochrome b6 . Interestingly, while heme binding is not an absolute prerequisite for the assembly of Cytochrome b6 into the complex, the fully formed complex without proper heme attachment shows increased sensitivity to proteases, indicating reduced stability . The assembly process is further regulated at the transcriptional and translational levels, as evidenced by studies showing that abundance and patterns of transcripts for the complex components remain consistent even when protein accumulation is reduced .

What expression systems are most effective for recombinant production of Cytochrome b6 in Synechococcus elongatus?

The selection of an appropriate expression system is critical for successful recombinant production of Cytochrome b6 in Synechococcus elongatus. Evidence from recent studies suggests that the pET expression system, originally designed for E. coli, can function efficiently when adapted for cyanobacteria such as S. elongatus . This system utilizes a dedicated T7 RNA polymerase for the expression of the gene of interest under the control of an inducible promoter, such as a nickel-inducible promoter . The advantage of this approach is that it provides a separate transcriptional system that doesn't compete with the native transcriptional machinery. Results have demonstrated that when properly implemented, this system can induce expression of heterologous genes at high levels compared to non-induced controls . For Cytochrome b6 specifically, successful expression requires consideration of cofactor availability, as proper folding and stability of the protein depend on correct heme attachment. The expression system should ideally be coordinated with pathways responsible for heme biosynthesis and attachment, such as the CCB pathway that mediates covalent binding of heme to Cytochrome b6 .

How can researchers effectively measure the accumulation and stability of recombinant Cytochrome b6?

Measuring the accumulation and stability of recombinant Cytochrome b6 requires a multifaceted approach that combines several biochemical and biophysical techniques. Western blotting with antibodies specific to Cytochrome b6 provides a straightforward method to quantify protein accumulation in thylakoid membrane preparations. For more precise quantification, researchers can employ in vivo pulse-labeling experiments using [35S]Met in the presence of cycloheximide (an inhibitor of nucleus-encoded protein synthesis), followed by immunoprecipitation to isolate the protein of interest . This approach allows monitoring of both synthesis rates and stability of newly synthesized proteins. Spectroscopic techniques are invaluable for assessing the functional integrity of Cytochrome b6, as the proper incorporation of heme groups gives rise to characteristic absorption spectra. Researchers should also consider evaluating the integration of Cytochrome b6 into the complete Cytochrome b6/f complex through blue native polyacrylamide gel electrophoresis (BN-PAGE), which preserves protein complexes in their native state. For detailed structural analysis, cryo-electron microscopy has emerged as a powerful tool to visualize the incorporation of recombinant proteins into larger complexes within the thylakoid membrane.

How does the CCB pathway regulate heme attachment to Cytochrome b6 and what are the implications for recombinant expression?

The CCB (cytochrome c biogenesis) pathway plays a crucial role in the covalent attachment of heme c(i) to Cytochrome b6 on the stromal side of thylakoid membranes, a process fundamental to the proper assembly and function of the Cytochrome b6/f complex . This pathway involves multiple CCB proteins (CCB1-4) that work in concert to facilitate the stereospecific attachment of heme to specific cysteine residues in Cytochrome b6. Mutations in genes encoding CCB pathway components result in defects in the accumulation of Cytochrome b6/f complex subunits and improper covalent binding of heme to Cytochrome b6 . Interestingly, research has demonstrated that heme binding is not an absolute prerequisite for the assembly of Cytochrome b6 into the Cytochrome b6/f complex, although complexes lacking properly attached heme show increased sensitivity to proteolytic degradation . For recombinant expression of Cytochrome b6, these findings have significant implications: successful expression strategies must ensure not only the production of the Cytochrome b6 protein but also the concurrent expression or availability of functional CCB pathway components. Expression systems that fail to coordinate these elements may yield properly folded apocytochrome b6 (without heme) that can assemble into complexes but will exhibit reduced stability and altered spectroscopic properties.

How do different light conditions affect the expression and assembly of recombinant Cytochrome b6 in Synechococcus elongatus?

Light conditions significantly influence the expression and assembly of recombinant Cytochrome b6 in Synechococcus elongatus through multiple regulatory mechanisms. Cyanobacteria such as Synechococcus employ complex antenna systems called phycobilisomes to efficiently harvest available light for photosynthesis, with their composition varying based on light quality and intensity . Under different light conditions, Synechococcus strains can exhibit chromatic acclimation, modifying their photosynthetic apparatus composition to optimize light harvesting . This acclimation process involves changes in the expression of photosynthetic proteins, including components of the electron transport chain such as the Cytochrome b6/f complex. When expressing recombinant Cytochrome b6, researchers must consider that high light intensities can increase oxidative stress, potentially affecting protein stability and heme attachment efficiency. Conversely, low light conditions may trigger upregulation of photosynthetic machinery but could potentially redirect cellular resources away from heterologous expression systems. Research has demonstrated that marine Synechococcus strains with different pigment types (PT2, PT3a, PT3c, etc.) have evolved distinct adaptations to various light environments, with corresponding variations in their photosynthetic apparatus . These natural adaptations provide valuable insights for optimizing light conditions when using Synechococcus as a recombinant expression host.

Why might recombinant Cytochrome b6 show reduced stability in Synechococcus elongatus expression systems?

Recombinant Cytochrome b6 may exhibit reduced stability in Synechococcus elongatus expression systems due to several interconnected factors related to protein processing and assembly. A primary cause can be inefficient heme attachment, as research has shown that while the absence of covalently bound heme doesn't prevent integration of Cytochrome b6 into the complex, it significantly increases sensitivity to proteolytic degradation . This finding suggests that complete post-translational processing, including proper cofactor attachment via the CCB pathway, is critical for protein stability. Overexpression of recombinant Cytochrome b6 without corresponding increases in other complex components can lead to accumulation of unassembled subunits, which are typically targeted for degradation by quality control mechanisms. Imbalances in the stoichiometry of complex components can trigger compensatory downregulation to maintain proper complex assembly. Additionally, expression of recombinant proteins may impose metabolic burdens that reduce cellular resources available for cofactor synthesis, including heme, further compromising protein stability. The choice of promoter and induction system can also impact stability; constitutive high-level expression may overwhelm post-translational processing machinery, while inducible systems like the nickel-inducible promoter system used with T7 RNA polymerase can provide better control over expression timing and levels .

How can researchers effectively distinguish between endogenous and recombinant Cytochrome b6 in experimental analyses?

Distinguishing between endogenous and recombinant Cytochrome b6 in experimental analyses requires strategic approaches that exploit subtle differences between the two protein forms. The most direct method involves incorporating epitope tags (such as His, FLAG, or HA tags) into the recombinant Cytochrome b6 construct, allowing specific detection using commercially available antibodies. These tags should be positioned carefully to avoid interfering with protein folding, heme binding, or complex assembly. For functional studies, researchers can introduce silent mutations that create unique restriction sites in the recombinant petB gene without altering the amino acid sequence, facilitating identification at the DNA level through restriction digestion patterns. Mass spectrometry provides a powerful approach for distinguishing the proteins based on mass differences resulting from even minor sequence variations, with techniques such as MRM (multiple reaction monitoring) enabling quantification of specific peptides unique to each form. Immunoprecipitation experiments using antibodies specific to unique regions or tags can selectively isolate either the endogenous or recombinant form for downstream analysis. Researchers can also employ pulse-chase experiments with radioactive labeling to track newly synthesized proteins, particularly effective when recombinant expression is under the control of an inducible system like the nickel-inducible promoter system .

What insights from research on Cytochrome b6 in Synechococcus elongatus can be applied to crop improvement?

Research on Cytochrome b6 in Synechococcus elongatus provides valuable insights that can be translated to crop improvement strategies, particularly in enhancing photosynthetic efficiency. The detailed understanding of the assembly and function of the Cytochrome b6/f complex in cyanobacteria offers a blueprint for similar processes in higher plants, as the fundamental components of photosynthetic electron transport are conserved across photosynthetic organisms . Studies showing that the accumulation of the Cytochrome b6/f complex can be affected by post-transcriptional processes rather than transcriptional regulation highlight the importance of considering protein stability and assembly when engineering photosynthetic improvements in crops . The identification of specific amino acid residues crucial for Cytochrome b6 function and stability provides potential targets for precision genome editing in crop plants using CRISPR-Cas systems. Insights into how light conditions affect the expression and assembly of photosynthetic components in Synechococcus can inform strategies for developing crops with improved photosynthetic performance under varying light environments, potentially enhancing crop resilience to fluctuating field conditions . Additionally, the development of experimental techniques for studying the Cytochrome b6/f complex in cyanobacteria, such as pulse-labeling and immunoprecipitation approaches, provides methodological frameworks that can be adapted for investigating similar processes in crop plants .

What emerging technologies will advance research on recombinant Cytochrome b6 in Synechococcus elongatus?

Emerging technologies across multiple disciplines are poised to significantly advance research on recombinant Cytochrome b6 in Synechococcus elongatus in the coming years. CRISPR-Cas genome editing technologies are revolutionizing precision genetic manipulation in cyanobacteria, enabling more efficient creation of Cytochrome b6 variants with specific modifications while minimizing off-target effects. These approaches will facilitate the creation of comprehensive variant libraries for structure-function studies. Advanced cryo-electron microscopy techniques now allow visualization of membrane protein complexes at near-atomic resolution, promising unprecedented structural insights into how recombinant Cytochrome b6 integrates into the complete b6/f complex within the native membrane environment. Single-cell analysis technologies, including fluorescence-based sorting methods, will enable high-throughput screening of Synechococcus mutant libraries for desired photosynthetic phenotypes resulting from Cytochrome b6 modifications. Synthetic biology approaches, including the development of standardized genetic parts specifically optimized for cyanobacteria, will streamline the design and construction of complex expression systems for recombinant proteins. The application of artificial intelligence for protein design and optimization promises to accelerate the development of Cytochrome b6 variants with enhanced stability or novel functions by predicting the effects of specific mutations before experimental validation. Integration of these technologies with systems biology approaches, including multi-omics analyses, will provide comprehensive understanding of how recombinant Cytochrome b6 variants affect the entire photosynthetic apparatus and cellular metabolism.

What potential applications exist for engineered Synechococcus elongatus strains with modified Cytochrome b6?

Engineered Synechococcus elongatus strains with modified Cytochrome b6 offer numerous potential applications spanning environmental remediation, sustainable bioproduction, and fundamental scientific research. In bioenergy applications, strains with optimized electron transport efficiency could enhance biomass production or be engineered to direct electron flow toward hydrogen or other biofuel precursor production. The ability of Synechococcus to utilize CO₂ as a carbon source creates opportunities for carbon capture technologies, with engineered strains potentially serving as biological carbon sinks in industrial settings where they could utilize CO₂ emissions while producing valuable compounds . Integration with first-generation ethanol production is particularly promising, as these cyanobacteria can utilize both CO₂ emissions and vinasse (nitrogen-rich waste) from ethanol production, creating a circular bioeconomy model that reduces environmental impact while producing valuable products . In fundamental research, strains with specific modifications to Cytochrome b6 serve as powerful tools for understanding electron transport mechanisms, providing insights into the evolution and optimization of photosynthesis. Photosynthetic biosensors based on engineered Synechococcus could exploit the sensitivity of photosynthetic electron transport to environmental factors, with Cytochrome b6 modifications potentially enhancing sensitivity to specific analytes. The demonstrated success in expressing heterologous proteins like β-glucosidase in Synechococcus suggests that these organisms could serve as production platforms for various high-value proteins using solar energy and minimal inputs .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.