Recombinant Synechococcus elongatus Cytochrome c biogenesis protein CcsB (ccsB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ccsB; ccs1; Synpcc7942_0322; Cytochrome c biogenesis protein CcsB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-456
Protein Length
full length protein
Species
Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)
Target Names
ccsB
Target Protein Sequence
MTSDPLASPSFADRWRRGQQLFWTWLADLRLAILLLLAIAIASATGTVIEQGQSLAFYQE NYPTDPALFGFLSWRWILSLGLDHVYRAGWFLGLLILFGASLTACTFRRQWPALRAAQRW QFYQEPRQFTKLALSASLPQGKLDSLEPLLLQRRYRLFRADDVLYARRGLAGRVGPILVH AGMLVVLGGAIWGSLGGFYAQEMIPSGETFQVRNIVDAGPWSGSRIPQDWAVKVNRFWID YAPDGRIDQFYSDLSVVDREGQEQDRQTIHVNQPLRYGGLTFYQADWAIAAAQVRLNNSP VLQLPMAQLPAAGRIWGTFVPTKPDLSSGVSLIAKDLQGTAVIYGSNGEPLGTLRKGMAI EVEGIRLSLVDLVGSTGLQIKSDPGIPWVYAGFLFVMVGVVCSYVSHAQVWALEQDGQLY IGGRSNRALVAFEQEMLAVLAQLDAQSNHSAETAIA
Uniprot No.

Target Background

Function
Essential for the biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f), specifically during heme attachment.
Database Links
Protein Families
Ccs1/CcsB family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of CcsB in Synechococcus elongatus PCC 7942?

CcsB in Synechococcus elongatus functions as a critical component of the CcsBA complex, which serves as a cytochrome c synthase and heme exporter. This integral membrane protein is responsible for the covalent attachment of heme to the CXXCH motif in apocytochrome c, a process essential for energy transfer in photosynthetic and respiratory pathways. The CcsBA complex is responsible for stereochemical heme attachment and subsequent release of cytochrome c from the synthase, facilitating proper folding into its native conformation .

Unlike the mitochondrial cytochrome c synthase (HCCS), the bacterial CcsBA system appears to have distinct substrate recognition requirements, particularly involving the CXXCH motif and surrounding residues. The bacterial system requires both thiols and histidine for substrate recognition but does not depend on the presence of alpha helix 1, which is a critical recognition feature for the mitochondrial system .

What methods are used for transformation of Synechococcus elongatus with recombinant CcsB constructs?

The transformation of Synechococcus elongatus PCC 7942 with recombinant constructs, including those containing CcsB, follows established protocols that have been optimized for this model cyanobacterium. The standard transformation procedure includes:

  • Culturing cells to mid-log phase (OD 730 of 1 to 2)

  • Incubating cells with approximately 100 ng of plasmid DNA for 24 hours in dark conditions

  • Spreading the cell-DNA mixture on BG-11 plates supplemented with appropriate selection antibiotics

  • Selection of recombinants using appropriate antibiotics (typically 10 μg/mL spectinomycin, 10 μg/mL kanamycin, or 3 μg/mL chloramphenicol)

  • Sub-culturing single colonies to prevent chromosomal segregation

  • Verification of chromosomal integration using PCR with specific oligonucleotide primers

This transformation approach can be used with SyneBrick vectors, which provide a standardized platform for gene expression in S. elongatus and contain various neutral sites for chromosomal integration .

How does the CcsBA complex participate in cytochrome c biogenesis?

The CcsBA complex in S. elongatus and other bacterial systems functions through a multi-step process that includes:

  • Recognition of the apocytochrome c substrate through specific motifs (particularly the CXXCH sequence)

  • Binding and export of heme across the membrane

  • Catalyzing the stereospecific covalent attachment of heme to the CXXCH motif via thioether bonds

  • Facilitating the release and proper folding of the mature cytochrome c

In vitro reconstitution experiments have revealed that CcsBA attaches heme to a variety of peptide substrates containing the CXXCH motif. When reconstituted in vitro, the reaction with wild-type CcsBA shows two characteristic heme absorption peaks: one at 560 nm (representing b-heme likely in the transmembrane histidine site) and another at 550 nm, which is characteristic of covalently attached heme in c-type cytochromes .

Time-course analysis of the in vitro reaction demonstrates that covalent attachment to apocytochrome c becomes measurable after approximately 20 minutes, reaching maximum levels at around 3 hours. Following synthesis, the mature cytochrome c is released from CcsBA and folds into its native state, as confirmed by HPLC size exclusion chromatography .

How do the recognition and attachment mechanisms differ between bacterial CcsBA and mitochondrial HCCS?

The bacterial CcsBA and mitochondrial HCCS systems display significant differences in substrate recognition and attachment mechanisms, highlighting evolutionary divergence in cytochrome c biogenesis pathways:

FeatureBacterial CcsBAMitochondrial HCCS
Minimal substrate requirementRecognizes 9-mer, 11-mer, 16-mer, and 20-mer peptides containing CXXCHRequires at least 16-mer peptide comprising CXXCH and adjacent alpha helix 1
Critical recognition motifsBoth thiols and histidine in CXXCH are requiredNeither thiol is critical for recognition, but alpha helix 1 is essential
Alpha helix 1 requirementNot required for recognitionRequired for recognition
Peptide release after heme attachmentPeptide substrates are released after heme attachmentHeme-attached peptide analogs are not released from the active site
Folding requirement for releaseLess dependent on folding for releaseFolding appears to be important in the release mechanism

In vitro reconstitution experiments demonstrated that bacterial CcsBA could attach heme to peptides as short as 9-mer and 11-mer containing the CXXCH motif, while HCCS required at least a 16-mer peptide that included both the CXXCH motif and the adjacent alpha helix 1. This indicates fundamentally different substrate recognition mechanisms between the two systems .

What expression systems are optimal for recombinant CcsB production in Synechococcus elongatus?

For optimal expression of recombinant proteins, including CcsB, in Synechococcus elongatus PCC 7942, researchers have developed specialized vector systems, most notably the SyneBrick vectors. These vectors provide several advantages for controlled expression:

  • Inducible promoter options:

    • LacI-pTrc induction system (recommended at 1 mM IPTG)

    • TetR-pTetA transcriptional system (inducible with aTc at 10-1000 nM)

    • These systems provide tunable expression levels with at least 10-fold induction

  • Chromosomal integration sites:

    • Three neutral sites (NSI, NSII, and NSIII) for stable integration

    • Each site allows for antibiotic selection markers (spectinomycin, kanamycin, or chloramphenicol)

  • Vector design features:

    • Standardized assembly approach based on BglBrick cloning

    • Does not require PCR amplification

    • Uses sequence-based homologous recombination

    • Not limited by automation or number of DNA fragment copies

For the LacI-regulated gene expression system, experiments with reporter genes have shown that 1 mM IPTG inducer can lead to up to 24-fold induction of expression in S. elongatus. Different fluorescent proteins showed varying induction levels, with eYFP demonstrating 24-fold higher induction with 1 mM IPTG compared to GFP .

What methodological approaches can be used to study CcsB protein interactions in Synechococcus elongatus?

Recent technological advances have enabled comprehensive analysis of protein interactions in S. elongatus, which can be applied to study CcsB and its interaction partners:

  • CyanoTag platform:

    • High-throughput protein tagging methodology specifically developed for S. elongatus

    • Allows for tagging and characterization of protein-coding genes (currently covering ~12% of the S. elongatus genome)

    • Enables visualization of protein localization and interactions through fluorescence microscopy

  • Protein interactome mapping:

    • Affinity purification experiments have successfully detected over half (2,714) of the known proteins in S. elongatus

    • The current interactome map includes 369 high-confidence protein-protein interactions

    • This approach has revealed interactions within and between large protein complexes, including photosystems, NDH-1 complex, and circadian clock regulatory proteins

  • Methodological pipeline:

    • Bait proteins (like CcsB) can be tagged and used to purify interaction partners

    • Mass spectrometry can identify co-purified proteins

    • Filtering protocols help identify high-confidence interactions (HCIs)

    • Resulting data can be compiled into interactome networks

For example, using the core structural component NdhN as bait, researchers identified eighteen other core or isoform-specific NDH-1 subunits as high-confidence interactions, demonstrating the power of this approach to map complex protein assemblies .

How can in vitro reconstitution of CcsBA be achieved for functional studies?

The in vitro reconstitution of CcsBA activity represents a significant methodological advancement that can be applied to study the function of CcsB. The key methodological components include:

  • Protein purification:

    • CcsBA must be purified as a detergent-solubilized membrane protein complex

    • Purification of CcsBA is particularly challenging due to its integral membrane protein nature and dual function as heme exporter and synthase

  • Reaction components:

    • Purified CcsBA with endogenous heme (co-purified) or exogenously loaded heme

    • Apocytochrome c substrate or peptide analogs containing the CXXCH motif

    • Reducing environment maintained with DTT

    • No additional accessory factors required beyond these components

  • Analytical methods:

    • Absorption spectroscopy to monitor characteristic peaks at 550 nm (covalently attached c-type heme) and 560 nm (b-heme)

    • SDS-PAGE with heme staining to confirm covalent attachment

    • Second-derivative spectra to delineate and quantitate the levels of attached heme

    • HPLC size exclusion chromatography to verify release and proper folding of cytochrome c products

Time-course analysis reveals that the covalent attachment can be detected as early as 20 minutes, with maximum product formation occurring at approximately 3 hours. The successful in vitro reconstitution demonstrates that purified CcsBA is sufficient to catalyze the stereospecific attachment of heme to apocytochrome c, followed by release and proper folding of the mature cytochrome .

What peptide recognition features guide CcsB-substrate interactions?

Understanding the peptide recognition features of CcsB is critical for designing studies of its function and for potential engineering applications. The bacterial CcsBA complex demonstrates distinct substrate recognition patterns:

  • Minimal recognition motifs:

    • CXXCH motif with both thiols and the histidine residue being critical for recognition

    • Peptides as short as 9-mer and 11-mer containing CXXCH are recognized and processed

    • Unlike the mitochondrial HCCS system, alpha helix 1 is not required for recognition by CcsBA

  • Peptide length requirements:

    • CcsBA successfully attaches heme to 9-mer, 11-mer, 16-mer, and 20-mer peptides containing the CXXCH motif

    • Even a 56-mer peptide (containing alpha helix 1 and 2 of cytochrome c) is recognized

  • Critical residues:

    • Both cysteine residues in the CXXCH motif are essential for recognition by CcsBA

    • The histidine residue in the CXXCH motif is also critical

    • These requirements differ significantly from the mitochondrial HCCS system, where neither thiol is critical for recognition

These recognition features provide insights into the evolutionary divergence between bacterial and mitochondrial cytochrome c biogenesis systems and offer potential targets for engineering modified CcsB proteins with altered substrate specificities.

What are the key considerations for optimizing transformation efficiency in Synechococcus elongatus?

Optimizing transformation efficiency for recombinant constructs in S. elongatus requires attention to several critical parameters:

  • Culture conditions:

    • Use cultures at mid-log phase (OD 730 of 1 to 2)

    • Ensure cells are in optimal physiological state before transformation

  • DNA quality and quantity:

    • Use approximately 100 ng of highly purified plasmid DNA

    • Ensure the DNA is free of contaminants that may affect transformation efficiency

  • Incubation conditions:

    • Incubate cell-DNA mixtures for 24 hours in dark conditions

    • Dark incubation appears to enhance DNA uptake and integration efficiency

  • Selection strategy:

    • Use appropriate antibiotics at optimal concentrations (10 μg/mL spectinomycin, 10 μg/mL kanamycin, or 3 μg/mL chloramphenicol)

    • Sub-culture single colonies to prevent chromosomal segregation and ensure homogeneity

  • Verification methods:

    • Use PCR with appropriate primers to verify chromosomal integration

    • Consider sequencing to confirm the integrity of the integrated construct

By carefully controlling these parameters, researchers can achieve reliable transformation of S. elongatus with constructs containing CcsB or other genes of interest.

How can protein-protein interactions involving CcsB be identified and validated?

Identifying and validating protein-protein interactions involving CcsB requires a multi-faceted approach:

  • High-throughput screening:

    • CyanoTag platform allows for efficient tagging and analysis of protein interactions

    • Affinity purification coupled with mass spectrometry can identify potential interaction partners

    • Current interactome studies in S. elongatus have already identified 369 high-confidence protein-protein interactions across various complexes

  • Filtering and validation:

    • Apply statistical thresholds to distinguish high-confidence interactions from background

    • Multiple experimental replicates increase confidence in identified interactions

    • Compare observed interactions with known protein complexes as internal controls

  • Visualization techniques:

    • Fluorescence microscopy using tagged proteins can reveal co-localization patterns

    • CyanoTag has been successfully used to visualize protein localization and potential interaction sites, such as the z-ring structure formed by FtsZ during cell division

  • Functional validation:

    • Genetic disruption of interaction partners can help validate functional relationships

    • Analysis of phenotypic changes (e.g., cell morphology, growth rates) can provide insights into the functional significance of protein interactions

The approach described in the CyanoTag studies, which successfully mapped interactions within complexes like photosystems I and II, the NDH-1 complex, and the circadian clock regulatory proteins, provides a valuable template for studying CcsB interactions in S. elongatus .

What methods can detect structural changes in CcsB during cytochrome c biogenesis?

Detecting structural changes in CcsB during the cytochrome c biogenesis process requires sophisticated biophysical and biochemical techniques:

  • Spectroscopic methods:

    • Absorption spectroscopy to monitor characteristic peaks that indicate conformational changes and heme coordination states

    • Second-derivative spectra can provide more detailed information about subtle spectral changes

    • Time-course analysis of spectral shifts can reveal the dynamics of structural transitions

  • Protein crosslinking and mass spectrometry:

    • Chemical crosslinking can capture transient interaction states during the biogenesis process

    • Mass spectrometry analysis of crosslinked peptides can reveal proximity relationships between domains

    • This approach can identify conformational changes that occur during substrate binding and processing

  • Mutational analysis:

    • Strategic mutations in CcsB can help identify residues critical for structural transitions

    • Comparison of wild-type and mutant protein activities can reveal the functional significance of specific structural features

    • This approach has been successfully used to study the role of histidine residues in the transmembrane domain of CcsBA

  • In vitro reconstitution with modified substrates:

    • Using peptide analogs with specific modifications can probe the structural requirements for substrate recognition and processing

    • Time-course analysis of reactions with different substrates can reveal how structural changes in CcsB correlate with different stages of the biogenesis process

These methodological approaches can provide insights into the structural dynamics of CcsB during its catalytic cycle, which is essential for understanding its function in cytochrome c biogenesis.

How can CcsB be utilized in metabolic engineering of Synechococcus elongatus?

The potential applications of CcsB in metabolic engineering of S. elongatus include:

  • Enhanced electron transport chain engineering:

    • Optimized expression of CcsB could improve cytochrome c maturation efficiency

    • Enhanced cytochrome c production might improve electron transfer in photosynthetic and respiratory pathways

    • This could potentially increase energy conversion efficiency for biotechnological applications

  • Integration with SyneBrick vector platform:

    • SyneBrick vectors provide a standardized platform for expressing multiple genes

    • CcsB expression can be controlled using inducible promoters

    • The system allows for integration at multiple chromosomal sites, enabling complex metabolic engineering approaches

  • CO2 conversion applications:

    • S. elongatus has been recognized for its potential in direct CO2 conversion to value-added chemicals

    • Engineering cytochrome c biogenesis through CcsB could potentially enhance electron transport capabilities supporting these conversion pathways

    • The SyneBrick platform facilitates reconstruction of metabolic pathways for biochemicals from CO2

  • Multi-gene expression strategies:

    • BglBrick standard vectors and derivative systems have been successfully applied for expressing multiple target genes

    • This approach could be used to co-express CcsB with other components of electron transport chains or metabolic pathways

The standardized assembly approaches based on BglBrick cloning do not require PCR amplification and use sequence-based homologous recombination, making them ideal for complex metabolic engineering applications requiring multiple gene expressions .

What research priorities should guide future studies of cytochrome c biogenesis in cyanobacteria?

Based on current knowledge and methodological capabilities, several research priorities emerge for future studies of cytochrome c biogenesis in cyanobacteria:

The methodology developed in the CyanoTag study, which has already characterized around 12% of the S. elongatus genome, provides a valuable foundation for these future research directions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.