Recombinant Synechococcus elongatus NAD (P)H-quinone oxidoreductase subunit 3 (ndhC)
Description
Introduction to Recombinant Synechococcus elongatus NAD(P)H-quinone Oxidoreductase Subunit 3 (ndhC)
Recombinant Synechococcus elongatus NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is a protein derived from the cyanobacterium Synechococcus elongatus. This protein is part of the NAD(P)H dehydrogenase complex, which plays a crucial role in electron transport chains and photosynthesis. The recombinant form of this protein is often expressed in Escherichia coli (E. coli) for research purposes.
Key Features of Recombinant ndhC
-
Species: Synechococcus elongatus (strain PCC 7942)
-
Source: Expressed in E. coli
-
Tag: Typically His-tagged for purification
-
Protein Length: Full-length (1-133 amino acids)
-
Purity: Greater than 90% as determined by SDS-PAGE
-
Storage: Lyophilized powder stored at -20°C or -80°C
Function and Role of NAD(P)H-quinone Oxidoreductase Subunit 3
NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is involved in the electron transport chain, specifically as part of the NAD(P)H dehydrogenase complex. This complex is crucial for transferring electrons from NAD(P)H to quinones, which are essential for generating ATP during photosynthesis and respiration in cyanobacteria.
Role in Photosynthesis
In cyanobacteria like Synechococcus elongatus, the NAD(P)H dehydrogenase complex contributes to cyclic electron flow around photosystem I (PSI), enhancing ATP synthesis without producing NADPH. This process is vital for balancing the ATP/NADPH ratio required for carbon fixation in the Calvin-Benson-Bassham cycle.
Research Applications and Findings
Recombinant ndhC proteins are used in various research applications, including studies on electron transport mechanisms and photosynthetic efficiency. For instance, Synechococcus elongatus has been engineered to produce high levels of heterologous enzymes, demonstrating its potential as a bioreactor for biotechnological applications .
Table: Characteristics of Recombinant Synechococcus elongatus NAD(P)H-quinone Oxidoreductase Subunit 3
| Characteristics | Description |
|---|---|
| Species | Synechococcus elongatus (strain PCC 7942) |
| Source | Expressed in E. coli |
| Tag | His-tagged |
| Protein Length | Full-length (1-133 amino acids) |
| Purity | Greater than 90% |
| Storage | Lyophilized powder at -20°C or -80°C |
| Amino Acid Sequence | MAKWNSDCSLEFGVFVLNGYEYLLGFLLISSLVPILSLTASRLLRPGRRGPERRTTYESG MEPIGGAWIQFNVRYYMFALVFVIFDVETVFLYPWAVAFNRLGLLAFVEALIFITILVVG LAYAWRKGALEWS |
Research on Cyanobacterial Bioreactors
Cyanobacteria like Synechococcus elongatus are being explored as bioreactors for producing enzymes and other compounds. Their ability to use CO2 and vinasse (a byproduct of ethanol production) as carbon and nitrogen sources makes them attractive for sustainable biotechnology applications .
Product Specs
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Target Background
NDH-1 (NAD(P)H-quinone oxidoreductase) shuttles electrons from an unidentified electron donor, via FMN and iron-sulfur (Fe-S) clusters, to quinones within the respiratory and/or photosynthetic electron transport chain. In this organism, plastoquinone is believed to be the immediate electron acceptor. The enzyme couples this redox reaction to proton translocation, conserving redox energy as a proton gradient. In cyanobacteria, NDH-1 also contributes to inorganic carbon concentration.
KEGG: syf:Synpcc7942_1180
STRING: 1140.Synpcc7942_1180
