Recombinant Synechococcus elongatus Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your preferred tag type for prioritized development.
Synonyms
ycf4; Synpcc7942_0654; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)
Target Names
ycf4
Target Protein Sequence
MPSPVATVETDSLQQPILGSRRPSNYFWAIAVSVGGTGLLLAGLSSYLQVNLLPFSEPTR LAFLPQGLVMGLYGIAAILLASYLWFVISLDVGGGYNAFDRKTQKATIFRWGFPGKNRRV EITYPLSDIQAVRVDIKEGLNPKRALYLKVKGRGDVPLTRVGQPLPLTELESQGAELARF LAVPLEGL
Uniprot No.

Target Background

Function

Appears essential for the assembly of the photosystem I complex.

Database Links
Protein Families
Ycf4 family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the function of Ycf4 in photosystem I assembly?

Ycf4 serves as one of four essential auxiliary factors required for the proper assembly of the photosystem I (PSI) reaction center subcomplex. During PSI assembly, Ycf4 stabilizes the reaction center (RC) subcomplex after receiving it from upstream assembly factors. The assembly process follows a specific sequence where Ycf3 assists in the initial assembly of newly synthesized PsaA/B subunits into an RC subcomplex, while Y3IP1 transfers this RC subcomplex to the Ycf4 module that provides stabilization . This critical handoff ensures the proper formation of the PSI complex, which is essential for photosynthetic electron transfer.

The cooperative involvement of Ycf4 with other factors (Ycf3, Y3IP1/CGL59, and Ycf37/PYG7/CGL71) creates a coordinated assembly pathway that protects the vulnerable intermediates during construction of the complex photosystem . Without this carefully orchestrated process, the assembly of the electron transfer cofactors and antenna pigments within the PSI complex would be compromised.

How does Ycf4 interact with photosystem components?

Ycf4 establishes extensive hydrogen bonding networks with various photosystem components, demonstrating its central role in photosystem assembly. These interactions have been characterized in detail, revealing differential binding patterns across the protein. The carboxyl terminus of Ycf4 typically forms more hydrogen bonds with photosystem components than the amino terminus, suggesting functional specialization of these regions .

The following table details the hydrogen bonding patterns between Ycf4 and key photosystem components:

Interacting ProteinTotal H-bonds (full-length Ycf4)H-bonds (amino terminus of Ycf4)H-bonds (carboxyl terminus of Ycf4)Bond Length Range (Å)
PsaA3352.74-3.07
PsaB75122.58-3.22
PsaC7182.50-3.19
PsaH74172.57-3.26
PsbA4382.67-3.28
PsbB4262.47-3.08
PsbC22132.68-3.12
PsbD3562.61-3.12

This extensive interaction network demonstrates Ycf4's engagement with both PSI subunits (PsaA-H) and PSII subunits (PsbA-E), with particularly strong interactions occurring at the carboxyl terminus . These molecular contacts provide insight into how Ycf4 might function as a molecular scaffold during photosystem assembly.

Is Ycf4 essential for photosynthetic organisms?

The essentiality of Ycf4 appears to vary between photosynthetic species. In tobacco chloroplasts, YCF4 gene deletion produces plants with severely compromised photosynthetic capacity, although they can still survive under specific conditions. These knockout plants exhibit profound physiological and ultrastructural alterations .

Chloroplasts in YCF4 knockout plants display significant structural changes, including transitions from oblong to rounded morphology, less densely packed thylakoid membranes, disorganized grana thylakoids, and the appearance of vesicular structures . Furthermore, knockout plants show dramatically reduced chlorophyll content, with levels decreasing up to 99.98% in non-photosynthetic cells as plants mature .

Physiological measurements confirm that Ycf4 deletion severely impacts photosynthetic parameters, including photosynthetic rate, transpiration rate, stomatal conductance, and sub-stomatal CO2 . These findings indicate that while Ycf4 may not be absolutely essential for survival in all contexts, it is critical for optimal photosynthetic function and development in plants.

What expression systems are optimal for recombinant Ycf4 production?

For recombinant Ycf4 production, the cyanobacterium Synechococcus elongatus PCC 7942 offers an excellent expression system with several advantages for photosynthetic protein research. This organism has a small genome size (2.7 Mb), making genetic manipulation straightforward, and possesses natural transformation capability for efficient introduction of foreign DNA .

The transformation of S. elongatus relies on homologous recombination between the cell's chromosome and exogenous DNA containing sequences homologous to the chromosome. The neutral site 1 (NS1) has been developed as a standard cloning locus that can be disrupted without affecting phenotype . When transformed with vectors containing an antibiotic resistance cassette and neutral site sequences, a double homologous recombination event occurs, inserting the selective marker (typically spectinomycin resistance) and the gene of interest into the neutral site with greater than 80% integration efficiency .

Optimized expression vectors for S. elongatus provide dual protein tags (6His-TEV and/or V5-His epitope tags) for detection and purification, enabling expression levels exceeding 10% of total soluble protein . For growth and maintenance, BG-11 Medium is specifically optimized for cyanobacteria, available as a 1X formulation to simplify media preparation .

How can native promoters enhance Ycf4 expression in cyanobacteria?

Utilizing native promoters, particularly the psbA2 promoter, offers significant advantages for recombinant Ycf4 expression in cyanobacteria. The psbA2 promoter, which normally drives expression of the D1 protein of photosystem II, responds to stress conditions and can be leveraged for enhanced protein production .

The integration of genes under psbA2 promoter control in S. elongatus PCC 7942 has been demonstrated without growth alterations in transgenic strains . This approach eliminates the need for costly exogenous inducers, reducing both expenses and potential cell stress associated with chemical induction systems .

Remarkably, expression from the psbA2 promoter can be further enhanced through application of magnetic fields. Studies show that exposure to 30 mT magnetic fields (MF30) increases transcription under the psbA2 promoter, likely through stress-induced shifts in gene expression and enzyme activity . This enhancement appears to positively impact photosystem II without disrupting the electron transport chain, aligning with the "quantum-mechanical mechanism" theory . The magnetic field approach provides a non-invasive method for boosting recombinant protein production in cyanobacterial systems.

What methods are most effective for purifying functional Ycf4?

  • Buffer optimization is critical, typically including:

    • pH range 7.0-8.0 to mimic chloroplast stroma conditions

    • Moderate salt concentration (150-300 mM NaCl)

    • Inclusion of glycerol (5-10%) as a stabilizing agent

    • Mild detergents when necessary for membrane-associated portions

  • Co-purification with interacting partners can enhance stability and functionality. Research indicates that Ycf4 functions in concert with other auxiliary factors (Ycf3, Y3IP1, CGL71), suggesting that co-expression and co-purification strategies may yield more native-like protein complexes .

  • When characterizing Ycf4 function, purification of PSI assembly intermediates that co-purify with Ycf4 can provide valuable insights into the assembly process. This approach has revealed the stepwise involvement of auxiliary factors in PSI assembly .

  • Temperature control during purification is essential, with procedures typically conducted at 4°C to preserve protein integrity and interaction capacity.

These purification approaches enable isolation of functional Ycf4 suitable for biochemical and structural studies to further elucidate its role in photosystem assembly.

How do the four auxiliary factors coordinate during PSI assembly?

The assembly of photosystem I reaction center involves sophisticated coordination between four auxiliary factors: Ycf3, Y3IP1/CGL59, CGL71, and Ycf4. Research using affinity chromatography and characterization of co-purified PSI assembly intermediates has revealed a stepwise assembly process .

Ycf3 initiates the process by assisting in the assembly of newly synthesized PsaA/B subunits into a reaction center (RC) subcomplex . Next, Y3IP1 (also known as CGL59) functions as an intermediary factor, transferring this initial RC subcomplex from Ycf3 to the Ycf4 module . The Ycf4 module then stabilizes the RC subcomplex after receiving it from Y3IP1 .

Additionally, CGL71 (also known as Ycf37/PYG7) forms an oligomeric structure that transiently interacts with the PSI RC subcomplex, physically protecting it under oxic conditions until association with the peripheral PSI subunits can occur . This protection is crucial during the vulnerable stages of assembly.

This coordinated handoff between auxiliary factors ensures proper assembly of the PSI reaction center complex, which must precisely incorporate electron transfer co-factors and antenna pigments to achieve functional photosynthesis . Disruption of any of these auxiliary factors can result in impaired PSI assembly and compromised photosynthetic capacity.

What structural changes occur in chloroplasts when Ycf4 is absent?

Electron microscopy studies have revealed dramatic ultrastructural alterations in chloroplasts lacking Ycf4. YCF4 knockout plants exhibit substantial changes in chloroplast morphology and internal membrane organization .

The most notable structural changes include:

  • Altered chloroplast shape: Chloroplasts in wild-type plants are oblong, while those in knockout plants become rounded .

  • Reduced chloroplast size: Knockout plants show smaller chloroplasts compared to wild-type plants .

  • Thylakoid membrane disorganization: Wild-type plants have densely packed thylakoid membranes, whereas knockout plants display less discrete grana thylakoids with disrupted orderly structure .

  • Formation of vesicular structures: As thylakoid membranes become disorganized in mutant chloroplasts, vesicular structures appear, indicating severe disruption of membrane architecture .

These ultrastructural changes correlate with profound physiological effects, including dramatically reduced chlorophyll content (decreasing up to 99.98% in mature non-photosynthetic cells of mutants) and severely compromised photosynthetic parameters . The structural alterations highlight the critical role of Ycf4 not just in PSI assembly but in maintaining proper chloroplast architecture and thylakoid membrane organization.

How does magnetic field application enhance Ycf4-mediated processes?

Magnetic field application (MF) has emerged as a novel approach to enhance recombinant protein production in cyanobacteria, with particular effectiveness for proteins expressed under the psbA2 promoter, which could include Ycf4 . Research has demonstrated that exposure to 30 mT magnetic fields (MF30) significantly increases transcription under the psbA2 promoter in Synechococcus elongatus PCC 7942 .

The mechanism appears to involve several interrelated effects on the photosynthetic machinery:

  • MF30 positively impacts photosystem II (PSII) without disrupting the electron transport chain, aligning with the "quantum-mechanical mechanism" theory .

  • The enhancement is likely attributed to stress-induced shifts in gene expression and enzyme activity, as the psbA2 promoter responds to stress conditions .

  • Fluorescence levels and gene expression measurements show significant differences between MF30 application and control conditions, confirming the biological effect .

This approach offers several advantages for enhancing recombinant protein production:

  • Non-invasive modulation of gene expression

  • No requirement for additional chemical inducers

  • Reduction in production costs

  • Compatibility with native promoters

The magnetic field enhancement strategy expands the toolkit for optimizing recombinant protein production in photoautotrophic microorganisms like S. elongatus, with potential applications for producing Ycf4 and other photosynthetic proteins for research and biotechnological purposes .

Why might Ycf4 knockout phenotypes vary between experiments?

Variability in Ycf4 knockout phenotypes between experiments can result from several factors that researchers should systematically address:

  • Growth condition differences: Photosynthetic organisms' phenotypes are highly sensitive to light intensity, temperature, and growth phase. Even subtle variations in these parameters can significantly affect the manifestation of Ycf4 knockout phenotypes . For consistent results, standardize light conditions (intensity and photoperiod), temperature, and growth stage at analysis.

  • Compensatory mechanisms: Photosynthetic organisms may activate compensatory pathways that partially mask the effects of Ycf4 deletion. The extent of compensation can vary between experiments and growth conditions . Analysis of global gene expression changes in knockout lines can help identify potential compensatory mechanisms.

  • Genetic background effects: The impact of Ycf4 deletion may vary depending on the genetic background of the organism. Different laboratory strains of S. elongatus or other model systems may have accumulated background mutations affecting photosystem assembly . Consider testing knockouts in multiple validated genetic backgrounds.

  • Incomplete knockout effects: In some systems, particularly those with multiple gene copies or when using RNAi/CRISPR approaches, the degree of Ycf4 reduction may vary. Verify knockout completeness by protein immunoblotting in each experiment.

  • Analysis timing: The phenotypic consequences of Ycf4 deletion can progress over time, with early developmental stages sometimes showing milder effects. Standardize the timing of phenotypic analysis relative to growth and development stage .

By systematically controlling these variables, researchers can achieve more consistent and interpretable results when studying Ycf4 knockout phenotypes.

How can researchers distinguish between direct and indirect effects of Ycf4 mutation?

Distinguishing between direct effects of Ycf4 absence and secondary consequences presents a significant challenge. To address this, researchers can employ several complementary approaches:

  • Temporal analysis following inducible Ycf4 depletion can help separate primary from secondary effects. Early changes (hours) after induction are more likely to represent direct consequences of Ycf4 absence, while later changes (days) often reflect secondary effects . This approach requires developing inducible expression systems for Ycf4.

  • Complementation studies provide critical evidence for direct effects. If reintroduction of wild-type Ycf4 rescues a specific phenotype, that phenotype is likely a direct consequence of Ycf4 absence . Domain-specific mutations can further pinpoint which regions of Ycf4 are responsible for particular functions.

  • Protein interaction analysis through affinity purification followed by mass spectrometry can identify proteins that directly interact with Ycf4 . Changes in proteins that directly interact with Ycf4 are more likely to represent primary effects of its absence.

  • Comparative phenotyping between Ycf4 mutants and mutants of known interacting partners (Ycf3, Y3IP1, CGL71) can help identify shared phenotypes that likely represent direct consequences of disrupting the PSI assembly pathway . Phenotypes unique to Ycf4 mutants may represent Ycf4-specific functions or secondary effects.

  • Ultrastructural analysis using electron microscopy at different time points after Ycf4 deletion can help establish the sequence of structural changes in chloroplasts, with earlier changes more likely representing direct effects .

These approaches, when used in combination, provide a more comprehensive understanding of Ycf4's direct functional roles versus the cascading consequences of disrupting photosystem assembly.

What are the key considerations when using Synechococcus elongatus UTEX 2973 for Ycf4 studies?

Synechococcus elongatus UTEX 2973 offers several advantages for Ycf4 studies compared to the more commonly used PCC 7942 strain, but requires specific considerations:

  • Growth rate differences: UTEX 2973 grows more than twice as fast as PCC 7942, which can accelerate experimental timelines but also necessitates adjustments to experimental protocols . Harvest times and growth measurements need to be calibrated specifically for this faster-growing strain.

  • Genetic similarities and differences: Despite their growth rate differences, these strains have very few genetic differences . Researchers should verify that Ycf4 and its interacting partners are conserved between strains before extrapolating results from one strain to the other.

  • Transformation protocols: While both strains are naturally transformable, optimal DNA concentrations and recovery conditions may differ for UTEX 2973 . Protocol optimization is recommended when first establishing transformation in this strain.

  • Expression systems compatibility: Expression vectors and promoters developed for PCC 7942 may function differently in UTEX 2973 due to potential differences in transcriptional machinery or regulatory networks . Validation of expression systems is essential when transitioning between strains.

  • Physiological differences: The enhanced growth rate of UTEX 2973 may be accompanied by differences in photosynthetic efficiency or stress responses . These physiological differences should be characterized and accounted for when studying Ycf4 function in photosystem assembly.

  • Industrial relevance: UTEX 2973 has been identified as having significant industrial potential . Research on Ycf4 in this strain may have more direct biotechnological applications, but should carefully distinguish between basic biological insights and applied outcomes.

By considering these factors, researchers can effectively leverage the advantages of S. elongatus UTEX 2973 for advancing our understanding of Ycf4 function while generating results with greater potential for biotechnological applications.

What promising approaches could enhance Ycf4-mediated photosystem assembly?

Several innovative approaches show promise for enhancing Ycf4-mediated photosystem assembly, with potential applications in both basic research and biotechnology:

These approaches, particularly when combined, have the potential to enhance photosynthetic efficiency, accelerate research on photosystem assembly, and contribute to biotechnological applications in biofuel production and enhanced crop productivity.

How might Ycf4 research contribute to enhancing cyanobacterial biotechnology?

Ycf4 research has significant potential to advance cyanobacterial biotechnology in several key areas:

By advancing our understanding of fundamental photosynthetic processes through Ycf4 research, scientists can develop more efficient and resilient cyanobacterial platforms for sustainable production of biofuels, chemicals, and other valuable compounds.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.