Recombinant Synechococcus elongatus Photosystem I reaction center subunit XI (psaL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psaL; Synpcc7942_2342; Photosystem I reaction center subunit XI; PSI subunit V; PSI-L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)
Target Names
psaL
Target Protein Sequence
MAQDVIANGGTPEIGNLATPINSSPFTRTFINALPIYRRGLSSNRRGLEIGMAHGFLLYG PFSILGPLRNTETAGSAGLLATVGLVVILTVCLSLYGNAGSGPSAAESTVTTPNPPQELF TKEGWSEFTSGFILGGLGGAFFAFYLASTPYVQPLVKIAAGVWSVH
Uniprot No.

Target Background

Database Links
Protein Families
PsaL family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional significance of PsaL in cyanobacterial photosystem I?

PsaL serves as a critical component of the photosystem I complex, playing a structural role in the organization of the light-harvesting system. It is one of the 12 core subunits of PSI in plants and cyanobacteria that collectively coordinate more than 200 prosthetic groups, including chlorophylls and carotenoids, to enable efficient light energy capture and transfer. In Synechococcus elongatus and other cyanobacteria, PsaL is particularly important for the formation of PSI trimers, a unique structural arrangement not found in plants. This trimeric organization is believed to enhance light-harvesting capacity under low-light conditions .

What genomic and evolutionary features characterize the psaL gene in Synechococcus elongatus?

The psaL gene in Synechococcus elongatus PCC 7942, a model cyanobacterium widely used in photosynthesis research, is conserved among photosynthetic organisms but shows characteristic features specific to cyanobacteria. Phylogenetic analysis of photosystem components reveals evolutionary relationships that can be visualized through phylogenetic trees, with branch lengths representing sequence divergence . The conservation of psaL across cyanobacterial species highlights its fundamental importance in photosynthetic function, while specific sequence variations may reflect adaptations to different ecological niches.

What are the optimal conditions for recombinant expression of Synechococcus elongatus PsaL?

Based on protocols established for other cyanobacterial proteins from Synechococcus elongatus, recombinant PsaL can be successfully expressed in E. coli expression systems. Optimization of expression conditions is critical for obtaining high yields of functional protein. The following table summarizes recommended expression parameters based on studies with similar cyanobacterial proteins:

ParameterRecommended ConditionsNotes
E. coli strainRosetta (DE3) or BL21 (DE3)-RILBoth strains support robust overexpression
Expression vectorpET-based with 6xHis tagFacilitates purification by affinity chromatography
Induction temperature16°C or 37°C16°C (overnight) for improved folding; 37°C (3 hours) for higher yield
IPTG concentration0.5-1.0 mMOptimal concentration may require optimization
Growth mediumLB or TBTB may yield higher cell density

Both Rosetta (DE3) and BL21 (DE3)-RIL strains have demonstrated robust overexpression of cyanobacterial proteins without significant differences in yield. Expression can be induced with IPTG either for 3 hours at 37°C or overnight at 16°C, with the lower temperature potentially favoring proper protein folding .

What purification strategy is most effective for obtaining high-purity recombinant PsaL?

A multi-step purification approach is recommended for obtaining PsaL with high purity suitable for biochemical and structural studies. Based on successful purification protocols for other cyanobacterial proteins, the following strategy can be employed:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin to capture the His-tagged protein

  • Intermediate purification: Ion exchange chromatography to separate based on charge properties

  • Polishing step: Size exclusion chromatography to achieve final purity and separate monomeric from oligomeric forms

  • Optional tag removal: TEV protease cleavage to remove the His-tag if required for structural studies

This approach has been shown to yield protein with apparent homogeneity suitable for biochemical and high-resolution structural studies including X-ray crystallography, cryo-electron microscopy, and NMR .

How can the XylS/Pm expression system be utilized for regulated production of PsaL?

The XylS/Pm regulator/promoter system represents an alternative expression platform for recombinant PsaL production with several advantages:

  • Induction flexibility: The system can be induced using cheap benzoic acid derivatives that enter cells by passive diffusion

  • Dose-dependent expression: The expression level can be precisely controlled by varying inducer concentration

  • Broad host range: The system functions well in E. coli and at least 7 other Gram-negative bacterial species

  • Temperature versatility: The system maintains functionality across a broad temperature range

For PsaL expression, the gene can be cloned into a plasmid vector under control of the Pm promoter, with expression regulated by XylS. This system allows for graded expression levels that can be optimized for protein solubility and proper folding. Furthermore, the system can be improved through combinatorial mutagenesis, allowing for the generation of expression cassettes with extended induction windows compared to wild-type systems .

What crystallization approaches are most successful for structural studies of photosystem components?

X-ray crystallography has been instrumental in elucidating the structure of photosystem I at atomic resolution. Based on successful crystallization of PSI complexes, the following approaches may be effective for structural studies of recombinant PsaL:

  • Crystal optimization: Development of stable crystal forms is crucial, as seen in the case of plant PSI where a highly stable crystal form enabled the measurement of weak native anomalous signals from iron, sulfur, and phosphate atoms

  • Phase determination: Using natively bound iron-sulfur clusters as initial phasing points can help overcome model bias in large membrane protein structures

  • Iterative model building: Starting with minimal models and gradually expanding the structure through iterative building and refinement

  • Density modification techniques: Methods such as DM can be employed to improve phases and enhance map quality

The structural determination methodology employed for the PSI-LHCI supercomplex at 2.8 Å resolution provides a valuable template for studies of individual components like PsaL. This approach revealed important details about how proteins interact with pigment molecules and how these interactions contribute to the remarkable efficiency of photosystem I .

How can researchers assess the functional activity of recombinant PsaL?

While PsaL itself does not possess enzymatic activity, its functional integration into the PSI complex can be assessed through multiple approaches:

  • Assembly assays: Reconstitution experiments with other PSI components to evaluate the ability of recombinant PsaL to form proper structural interactions

  • Pigment binding analysis: Spectroscopic analysis to determine whether recombinant PsaL correctly binds chlorophyll and carotenoid molecules

  • Energy transfer measurements: Time-resolved fluorescence spectroscopy to evaluate the efficiency of energy transfer in reconstituted complexes

  • Structural integrity assessment: Circular dichroism spectroscopy to verify proper secondary structure formation

These functional assessments can provide valuable insights into whether recombinant PsaL maintains native-like properties. For related cyanobacterial proteins, functional activity assays have confirmed that purified recombinant proteins retain their native biochemical properties .

What techniques are available for studying protein-protein interactions involving PsaL?

Understanding how PsaL interacts with other PSI components is crucial for elucidating its role in complex assembly. Several techniques can be employed:

  • Co-immunoprecipitation: Using antibodies against PsaL to pull down interacting partners

  • Crosslinking mass spectrometry: To identify amino acid residues involved in protein-protein interactions

  • Surface plasmon resonance: For quantitative measurement of binding affinities

  • Yeast two-hybrid or bacterial two-hybrid assays: To screen for potential interaction partners

  • Native mass spectrometry: To analyze intact protein complexes and their composition

These approaches can reveal how PsaL contributes to the assembly and stability of the PSI complex. Such interaction studies could identify residues critical for complex formation, potentially guiding mutagenesis experiments to probe structure-function relationships.

How can researchers address solubility issues with recombinant PsaL?

As a membrane protein component of PSI, PsaL presents challenges for recombinant expression and solubilization. Several strategies can help overcome these challenges:

  • Expression optimization:

    • Lowering induction temperature to 16°C improves protein folding

    • Reducing inducer concentration to slow expression rate

    • Testing different E. coli strains optimized for membrane protein expression

  • Solubilization approaches:

    • Using appropriate detergents for membrane protein extraction (e.g., n-dodecyl-β-D-maltoside)

    • Incorporating detergent screening to identify optimal solubilization conditions

    • Employing amphipathic polymers like SMA (styrene-maleic acid) for native-like membrane protein extraction

  • Fusion partners:

    • Testing solubility-enhancing fusion partners such as MBP (maltose-binding protein)

    • Utilizing the 5'-terminal fusion partners that have been shown to stimulate expression of recombinant genes in the XylS/Pm system

The experience with other cyanobacterial proteins indicates that careful optimization of expression conditions can yield properly folded, functional protein in sufficient quantities for biochemical and structural studies .

What are the critical quality control assessments for recombinant PsaL preparations?

Ensuring the quality and native-like properties of recombinant PsaL is essential for meaningful functional and structural studies. Key quality control assessments include:

  • Purity analysis:

    • SDS-PAGE with Coomassie staining to verify protein purity

    • Mass spectrometry to confirm protein identity and detect post-translational modifications

  • Oligomeric state determination:

    • Size exclusion chromatography to analyze quaternary structure

    • Analytical ultracentrifugation to determine oligomerization state

    • Native gel electrophoresis to assess complex formation

  • Structural integrity:

    • Circular dichroism spectroscopy to evaluate secondary structure content

    • Thermal shift assays to assess protein stability

    • Limited proteolysis to probe for correctly folded domains

  • Functional verification:

    • Pigment binding assays to confirm interaction with chlorophylls and carotenoids

    • Reconstitution experiments with other PSI components

These quality control measures help ensure that the recombinant protein preparation closely resembles the native state, increasing the reliability of subsequent experimental results.

How do mutations in psaL affect photosystem I assembly and function?

Site-directed mutagenesis of the psaL gene can provide valuable insights into structure-function relationships. Researchers can systematically design mutations based on:

  • Conserved residues: Targeting amino acids conserved across species may reveal functionally critical sites

  • Interface residues: Mutating residues at the interface with other PSI subunits can disrupt specific interactions

  • Pigment binding sites: Altering residues involved in chlorophyll or carotenoid binding can affect energy transfer efficiency

The impact of these mutations can be assessed through multiple parameters:

Analysis TypeMeasurementExpected Impact of Disrupting Mutations
Complex formationBN-PAGE, size exclusion chromatographyAltered oligomeric state, impaired trimer formation
Pigment bindingAbsorption spectroscopy, fluorescenceShifted spectra, reduced pigment content
Energy transferTime-resolved fluorescenceDecreased energy transfer efficiency, altered kinetics
Photochemical activityOxygen evolution, P700 oxidationReduced photochemical quantum yield

The mutagenesis approaches developed for other expression systems can be adapted for psaL studies. For example, the combinatorial mutagenesis and selection methods using the bla gene as a reporter, as demonstrated with the XylS/Pm system, could be applied to optimize psaL expression and study the effects of mutations on protein function .

How can cryo-electron microscopy complement X-ray crystallography in PsaL structural studies?

While X-ray crystallography has been the gold standard for high-resolution structural studies of photosystem components, cryo-electron microscopy (cryo-EM) offers complementary advantages:

  • Sample requirements: Cryo-EM requires less protein and eliminates the need for well-ordered crystals, which can be challenging to obtain for membrane proteins

  • Native-like conditions: Proteins can be visualized in a more native-like environment without crystal packing constraints

  • Conformational heterogeneity: Cryo-EM can resolve multiple conformational states present in the sample

  • Structural dynamics: Recent advances in time-resolved cryo-EM open possibilities for capturing different functional states

For PsaL research, combining X-ray crystallography and cryo-EM approaches can provide more comprehensive structural insights. The purification protocols established for crystallography studies of photosystem I are also suitable for preparing samples for cryo-EM analysis .

What aspects of PsaL research could benefit from integration with synthetic biology approaches?

Synthetic biology offers innovative approaches to study and manipulate PsaL function:

  • Designed variants: Creating synthetic PsaL variants with altered properties to probe structure-function relationships

  • Orthogonal expression systems: Developing specialized expression platforms for membrane proteins like PsaL

  • Minimal PSI systems: Engineering simplified photosystems to understand essential components and interactions

  • Novel applications: Incorporating modified PsaL into biohybrid energy conversion devices

The XylS/Pm regulator/promoter system represents one such synthetic biology tool that can be optimized for PsaL expression. This system has been extensively engineered through mutagenesis to create altered and extended expression profiles suitable for various applications, including heterologous protein production .

How might computational approaches enhance PsaL research?

Computational methods offer powerful tools for PsaL research across multiple dimensions:

  • Structural prediction: AlphaFold and other AI-based tools can predict PsaL structures in species where experimental structures are unavailable

  • Molecular dynamics simulations: Revealing dynamic aspects of PsaL function not captured by static structures

  • Evolutionary analysis: Identifying conserved features and coevolving residues to pinpoint functionally important regions

  • Energy transfer modeling: Simulating excitation energy transfer pathways involving chlorophylls bound to PsaL

These computational approaches can guide experimental design and help interpret experimental results. For example, molecular dynamics simulations could reveal how PsaL contributes to the remarkable near-perfect quantum efficiency of energy transfer in photosystem I .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.