Recombinant Synechococcus elongatus Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Production and Optimization Strategies

Genetic Engineering

  • Promoter Systems: The psbA2 promoter, responsive to stress, enhances recombinant protein (RP) yield under light or oxidative stress .

  • Magnetic Field (MF) Application: Exposure to 30 mT increases transcription efficiency by 20–30%, likely via stress-induced modulation of photosynthetic machinery .

Challenges and Solutions

  • Stability: Psb28 and Psb34 proteins stabilize CP47 during assembly, preventing photodamage .

  • Yield Improvements: Codon optimization and fusion tags (e.g., His-tag) improve solubility and purification efficiency .

Applications in Biotechnology

Research Tools

  • Photosynthesis Studies: Used to probe chlorophyll-protein interactions and PSII repair mechanisms .

  • Stress Response Models: Recombinant CP47 helps analyze cyanobacterial adaptation to high-light conditions .

Industrial Potential

  • Bioenergy: Engineered Synechococcus strains with overexpressed CP47 could enhance photosynthetic efficiency for biofuel production .

  • Biosensors: Tagged CP47 variants enable real-time monitoring of PSII dynamics in environmental stress assays .

Key Research Findings

StudyDiscoveryCitation
PsbB gene knockoutLoss of CP47 abolishes PSII activity, confirming its essential role .
Magnetic field enhancement30 mT exposure boosts ZsGreen1 (reporter) transcription under psbA2 .
Psb28 interactionPsb28 stabilizes CP47 assembly intermediates, preventing phycobilisome binding .
Recombinant production in E. coliFull-length CP47 (508 aa) successfully expressed with His-tag .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psbB; Synpcc7942_0697; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLIAVHLMHTALVAGWAGSMALYELAIFDPSDAVLNPMWRQGM FVLPFMARLGVTQSWGGWSITGETAVDPGYWSFEGVAIAHIVLSGLLFLAAVWHWVYWDL ELFTDPRTGEPALDLPKMFGIHLFLSGLLCFGFGAFHLSGLWGPGMWVSDPYGLTGHVQP VAPAWGPEGFNPFNPGGIVAHHIAAGVVGIVAGLFHLTVRPPERLYKALRMGNIETVLSS SLAAVFFAAFVVAGTMWYGNAATPVELFGPTRYQWDQGYFRQEIARRVDTAVASGASLEE AWSSIPEKLAFYDYVGNSPAKGGLFRTGQMNKGDGIAQGWLGHAVFKDKNGDVLDVRRLP NFFENFPIVLTDSKGAVRADIPFRRAEAKFSFEETGITASFYGGSLNGQTITDPAQVKKY ARKAQLGEAFEFDTETLNSDGVFRTSPRGWFTFGHASFALLFFFGHIWHGSRTLFRDVFA GIEADLGEQIEFGAFQKLGDPTTRKTAA
Uniprot No.

Target Background

Function

A core component of the Photosystem II (PSII) complex. It binds chlorophyll and facilitates the primary light-driven photochemical reactions of PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H₂O, generating O₂ and a proton gradient for subsequent ATP formation.

Database Links
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of CP47 (psbB) in Photosystem II of Synechococcus elongatus?

CP47, encoded by the psbB gene, is a core chlorophyll-binding protein of Photosystem II that functions as an internal antenna system. It contains six transmembrane helices and binds approximately 16 chlorophyll molecules. CP47 transfers excitation energy from the peripheral light-harvesting complexes to the reaction center of Photosystem II, playing a crucial role in the primary photochemistry of oxygenic photosynthesis. Structurally, it is closely related to CP43 (encoded by psbC) and both proteins contribute to the organization and stability of the oxygen-evolving complex .

What expression systems are available for recombinant production of CP47 in Synechococcus elongatus?

For recombinant expression of CP47 in Synechococcus elongatus PCC 7942, researchers typically use specialized vectors such as the GeneArt Synechococcus Protein Expression Vector (pSyn_6). This vector allows integration into specific neutral sites in the S. elongatus chromosome via homologous recombination. The pSyn_6 vector contains:

  • A spectinomycin resistance cassette for selection

  • Neutral site sequences for targeted chromosomal integration

  • Multiple cloning sites (MCS) allowing for N- and C-terminal polyhistidine tags

  • Options for TEV protease cleavage sites and V5 epitope tags

  • Promoter sequences for controlled expression

When working with psbB, codon optimization is often necessary due to the high GC content of the S. elongatus genome, which significantly improves expression levels of recombinant genes .

How do mutations in the psbB gene affect energy transfer dynamics within Photosystem II?

Mutations in the psbB gene can significantly alter energy transfer dynamics within Photosystem II by affecting:

Mutation TypeRegion AffectedImpact on Energy TransferPhotosynthetic Efficiency
Conserved His residuesChlorophyll binding sitesSevere disruption of energy coupling>70% reduction
Transmembrane helicesProtein folding/stabilityModerate disruption of energy pathways30-50% reduction
Large hydrophilic loopExtrinsic interactionsMinimal effect on energy transfer, may affect regulatory mechanisms5-15% reduction
C-terminal domainStromal-facing regionVariable effects, depending on specific residues10-40% reduction

Site-directed mutagenesis studies reveal that the most critical residues for energy transfer are those directly coordinating chlorophyll molecules, particularly histidine residues in the transmembrane helices .

What are the comparative differences in CP47 structure and function between Synechococcus elongatus PCC 7942 and Synechococcus 2973?

Despite their close evolutionary relationship, the CP47 proteins from Synechococcus elongatus PCC 7942 and Synechococcus 2973 show subtle differences that may contribute to their different physiological properties:

  • Sequence conservation: The psbB gene is highly conserved between these strains, with >99% sequence identity at the protein level.

  • Expression regulation: Differences in the circadian control of psbB expression exist between the two strains, potentially linked to the RpaA transcriptional master regulator, which affects natural competence and may indirectly influence photosynthetic gene expression patterns.

  • Photosynthetic efficiency: Synechococcus 2973 shows faster growth rates (doubling time of approximately 1.5 hours compared to 4 hours for PCC 7942), which may be partially attributed to differences in the photosynthetic apparatus, including potential post-translational modifications or interactions of CP47 .

How does the integration of recombinant psbB affect native photosystem assembly and function?

When integrating recombinant psbB into the Synechococcus elongatus genome, several considerations must be addressed:

  • Dosage effects: The presence of both native and recombinant psbB can lead to competition for assembly factors and potentially alter the stoichiometry of photosystem components.

  • Assembly kinetics: Recombinant CP47 may be incorporated into PSII at different rates than native protein, particularly if codon usage or regulatory elements are altered.

  • Heterogeneity in PSII complexes: Mixed populations of PSII complexes containing native or recombinant CP47 may form, complicating analysis.

To address these challenges, researchers often employ:

  • Targeted replacement of the native psbB gene rather than ectopic expression

  • Use of neutral site integration followed by knockout of native psbB

  • Careful phenotypic characterization to ensure proper photosystem function, including measurements of oxygen evolution, fluorescence induction, and photochemical efficiency

What is the optimal transformation protocol for introducing recombinant psbB into Synechococcus elongatus?

The most effective transformation protocol for introducing recombinant psbB into Synechococcus elongatus PCC 7942 leverages the organism's natural competence:

  • Culture preparation:

    • Grow S. elongatus PCC 7942 in BG-11 medium to log phase (OD750 of 1-2)

    • Harvest cells by centrifugation (4,000 × g for 10 minutes)

    • Resuspend in fresh BG-11 to a concentration of ~1 × 10^8 cells/mL

  • DNA preparation:

    • Use high-quality, supercoiled plasmid DNA (1-5 μg)

    • For psbB integration, circular DNA typically yields higher transformation efficiency than linear DNA

    • DNA methylation state can affect transformation efficiency; unmethylated DNA often yields better results

  • Transformation procedure:

    • Mix 100 μL of cell suspension with 1-5 μg of plasmid DNA

    • Incubate in darkness at 34°C for 16-24 hours (darkness increases transformation efficiency)

    • After incubation, expose cells to medium light (40-100 μmol·m^-2·s^-1) for 4 hours

    • Plate on selective BG-11 medium containing appropriate antibiotics (typically spectinomycin at 10-20 μg/mL)

  • Colony selection:

    • Colonies generally appear after 7-10 days

    • Screen transformants using PCR to verify proper integration

    • Perform segregation by repeated streaking on selective media until all chromosomal copies contain the recombinant psbB insert

How should codon optimization be approached for psbB expression in Synechococcus elongatus?

Codon optimization for psbB expression in Synechococcus elongatus requires careful consideration of the organism's unusual codon preferences:

  • General GC content considerations:

    • The S. elongatus genome has ~55.5% GC content

    • Position-specific GC bias exists: 1st position ~64% GC, 2nd position ~44% GC, and 3rd position ~60% GC

    • This pattern should be maintained in the optimized sequence

  • Codon usage optimization strategy:

    • Analyze codon usage in highly expressed S. elongatus genes as a reference

    • Prioritize codons that appear in highly expressed photosynthetic genes

    • Avoid introducing rare codons that may cause translational pausing

  • Structural considerations for psbB:

    • Preserve regulatory sequences or RNA secondary structures that may influence expression

    • For membrane proteins like CP47, consider codon usage patterns specific to transmembrane regions

  • Implementation approaches:

    • Use specialized gene synthesis services that offer cyanobacteria-specific codon optimization

    • The GeneArt Gene Synthesis service can synthesize codon-optimized psbB genes adapted to S. elongatus codon preferences

    • Validate optimized sequences using codon adaptation index (CAI) tools specific for cyanobacteria

What purification methods are most effective for isolating recombinant CP47 from Synechococcus elongatus?

The purification of recombinant CP47 presents challenges due to its membrane-embedded nature and the need to maintain structural integrity. The following methodological approach is recommended:

  • Cell disruption and membrane isolation:

    • Harvest cells at late exponential phase

    • Disrupt cells using glass beads, French press, or sonication in buffer containing 50 mM HEPES (pH 7.5), 10 mM MgCl2, 5 mM CaCl2, and 25% glycerol

    • Collect thylakoid membranes by differential centrifugation (40,000 × g for 30 minutes)

  • Membrane solubilization:

    • Solubilize membranes with 1% n-dodecyl-β-D-maltoside (DDM) or 1% digitonin

    • Incubate for 30 minutes at 4°C with gentle stirring

    • Remove insoluble material by centrifugation (100,000 × g for 45 minutes)

  • Affinity purification (for His-tagged CP47):

    • Load solubilized material onto Ni-NTA affinity column

    • Wash with 10-20 column volumes of buffer containing 0.03% DDM and 20 mM imidazole

    • Elute with buffer containing 250 mM imidazole

  • Additional purification steps:

    • Apply size exclusion chromatography to separate CP47-containing complexes

    • Use ion exchange chromatography for further purification if necessary

  • Tag removal (if applicable):

    • For constructs with TEV protease cleavage sites, treat with TEV protease

    • Remove the cleaved tag by reverse affinity chromatography

Purification StepBuffer CompositionCritical ParametersExpected Purity
Membrane isolation50 mM HEPES pH 7.5, 10 mM MgCl2, 5 mM CaCl2, 25% glycerolTemperature (4°C), Protease inhibitorsCrude membrane fraction
SolubilizationAbove buffer + 1% DDM or digitoninDetergent:protein ratio (10:1 w/w)>30% purity
Ni-NTA affinity50 mM HEPES pH 7.5, 100 mM NaCl, 0.03% DDMImidazole gradient, flow rate>70% purity
Size exclusion25 mM MES pH 6.5, 10 mM CaCl2, 10 mM MgCl2, 0.03% DDMColumn selection, flow rate>90% purity

Throughout all purification steps, it is essential to maintain samples at 4°C and under dim green light to prevent photodamage to the chlorophyll molecules .

Why is my recombinant CP47 (psbB) not properly integrating into the Synechococcus genome?

Several factors can affect successful integration of recombinant psbB into the Synechococcus elongatus genome:

  • DNA quality and configuration:

    • Supercoiled plasmid DNA typically yields better transformation efficiency than linear DNA

    • The structural configuration of the donor DNA significantly impacts transformation efficiency:

      • Intact circular plasmids show highest efficiency

      • Linearized plasmids with intact flanking regions show moderate efficiency

      • DNA fragments lacking backbone buffer regions show dramatically reduced efficiency (up to 270-fold decrease)

  • Homology arm considerations:

    • Ensure sufficient length of homology arms (700-1000 bp is optimal)

    • Verify that homology sequences exactly match the target neutral site

    • Buffer regions that protect homology arms from exonuclease activity significantly improve transformation efficiency

  • Physiological state of cells:

    • Log phase cultures (OD750 of 1-2) are most competent

    • Dark incubation during transformation increases efficiency

    • Cells grown under constant light conditions may have reduced competence

  • Methylation patterns:

    • DNA methylation can affect transformation efficiency

    • DNA amplified by PCR (unmethylated) sometimes performs better than E. coli-derived plasmid DNA

If integration issues persist, try:

  • Increasing donor DNA concentration (up to 5-10 μg)

  • Extending the dark incubation period to 24-36 hours

  • Performing natural transformation using freshly prepared cells

  • Using neutral site 1 (NS1) which has been extensively validated for recombinant protein expression

How can I address poor expression levels of recombinant CP47 in Synechococcus elongatus?

Poor expression of recombinant CP47 can stem from multiple causes:

  • Codon optimization issues:

    • Insufficient adaptation to S. elongatus codon bias can reduce translation efficiency

    • Verify that the gene has been optimized according to the organism's position-specific GC content (1st letter ~64%, 2nd letter ~44%, 3rd letter ~60%)

    • Analyze and eliminate rare codons that may cause translational pausing

  • Promoter strength and regulation:

    • The choice of promoter significantly affects expression levels

    • Consider using strong constitutive promoters (e.g., psbA, rbcL) or inducible systems

    • Ensure proper spacing between promoter elements and start codon

  • Protein stability and turnover:

    • CP47 requires proper insertion into membranes and association with other PSII proteins

    • Co-expression of chaperones or assembly factors may improve stable integration

    • Modify growth conditions (light intensity, temperature) to reduce protein degradation

  • Physiological burden:

    • Overexpression of membrane proteins can stress cells

    • If using high-copy plasmids, consider chromosomal integration at controlled copy number

    • Implement gradual induction strategies to allow adaptation

  • Detection methods:

    • Ensure antibodies or detection methods are appropriate for the recombinant protein

    • For His-tagged constructs, verify tag accessibility in the folded protein

    • Consider native PAGE for membrane proteins rather than SDS-PAGE

How are CRISPR-Cas techniques being applied to study psbB function in Synechococcus elongatus?

CRISPR-Cas technology has revolutionized genetic manipulation in cyanobacteria, offering new approaches to study psbB function:

  • Precise genome editing:

    • CRISPR-Cas9 or Cas12a systems allow precise modifications to psbB without requiring selection markers

    • Single nucleotide changes can be introduced to study specific amino acid functions

    • Multiple simultaneous modifications can be made to study synergistic effects

  • Transcriptional regulation:

    • CRISPR interference (CRISPRi) with catalytically inactive Cas9 (dCas9) enables partial knockdown of psbB

    • This approach allows studying essential genes like psbB without lethal effects

    • Tunable repression through guide RNA design or inducible systems provides temporal control

  • High-throughput functional studies:

    • CRISPR-based screens can systematically interrogate protein domains

    • Creation of variant libraries to identify critical regions for energy transfer

    • Coupling with selection methods based on photosynthetic fitness

  • Novel applications:

    • Tagging endogenous psbB with fluorescent proteins for in vivo localization

    • Creation of optogenetic tools for controlling expression

    • Engineering synthetic photosystems with modified energy transfer properties

For optimal results with CRISPR-Cas in Synechococcus elongatus, researchers should consider:

  • Using species-specific promoters for Cas protein expression

  • Optimizing guide RNA design for the high GC content genome

  • Implementing strategies to enhance homology-directed repair through the natural competence pathways

What are the implications of studying CP47 variants across different cyanobacterial species?

Comparative analysis of CP47 across cyanobacterial species provides valuable insights:

  • Evolutionary adaptations:

    • CP47 belongs to the CP43-like class of chlorophyll-binding proteins, which includes CP43, the N-terminal domains of PsaA/PsaB of Photosystem I, and the light-harvesting proteins encoded by isiA and pcb genes

    • Cross-species comparison reveals conserved functional domains and species-specific adaptations

    • Understanding the molecular evolution of these proteins illuminates the diversification of photosynthetic mechanisms

  • Structure-function relationships:

    • CP47 variants from different species exhibit adaptations to specific light environments

    • Comparing fast-growing strains (like Synechococcus 2973) with conventional models (like PCC 7942) can reveal modifications that enhance photosynthetic efficiency

    • These comparisons help identify critical vs. adaptable regions of the protein

  • Biotechnological applications:

    • Identification of CP47 variants with enhanced stability or efficiency

    • Engineering chimeric proteins combining beneficial features from different species

    • Development of cyanobacterial chassis with optimized photosynthetic capacity

  • Environmental adaptations:

    • CP47 variants from species adapted to extreme environments may exhibit stress tolerance mechanisms

    • Understanding these adaptations can inform strategies for engineering stress-resistant photosynthetic organisms

Cyanobacterial SpeciesCP47 Distinctive FeaturesGrowth RateEnvironmental Adaptation
Synechococcus elongatus PCC 7942Standard model systemModerate (4h doubling time)Freshwater/laboratory adapted
Synechococcus sp. PCC 2973Nearly identical to PCC 7942 but with key differences in regulationFast (1.5h doubling time)High light tolerance
Marine Synechococcus speciesModifications for salt/light conditionsVariableMarine environment
Thermosynechococcus speciesHeat-stable versionsModerateThermal springs

These comparative studies highlight how small differences in the psbB gene and its regulation can lead to significant physiological differences, even between closely related strains like Synechococcus PCC 7942 and Synechococcus 2973 .

How can synthetic biology approaches enhance our understanding of CP47 in photosynthetic systems?

Synthetic biology offers innovative approaches to study and engineer CP47 function:

  • Modular protein design:

    • CP47 contains six transmembrane helices that bind chlorophyll molecules

    • Synthetic biology approaches can redesign these modules to alter energy transfer pathways

    • Creation of minimal or expanded versions to test structural constraints on function

  • Alternative pigment incorporation:

    • Engineering CP47 variants capable of binding alternative chlorophylls or synthetic chromophores

    • Extending the spectral range of light absorption

    • Creating novel energy transfer systems with modified efficiency or directionality

  • Orthogonal expression systems:

    • Development of tightly controlled expression systems specific for photosynthetic proteins

    • Light-responsive or metabolite-responsive regulation of CP47 expression

    • Fine-tuning stoichiometry of photosystem components

  • Integration with non-photosynthetic systems:

    • Coupling CP47-based light harvesting to non-native electron transport chains

    • Engineering light-responsive biosensors based on CP47 structure

    • Creation of hybrid photosynthetic-electronic interfaces

  • Chassis optimization:

    • Synechococcus elongatus PCC 7942 serves as an excellent synthetic biology chassis due to its small genome size (2.7 Mb) and natural transformability

    • The newly engineered Synechococcus 2973-T strain combines natural competence with rapid growth rate

    • These optimized chassis provide platforms for testing CP47 variants and synthetic photosystems

Synthetic biology approaches benefit from the detailed structural knowledge now available for photosystem components and can leverage this information to rationally design modified systems with enhanced or novel properties .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.