Recombinant Synechococcus elongatus Photosystem Q (B) protein 1

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Synechococcus elongatus Photosystem Q (B) protein 1

Recombinant Synechococcus elongatus Photosystem Q (B) protein 1, also known as Photosystem II D1 protein, is a crucial component of the photosynthetic apparatus in cyanobacteria. This protein plays a pivotal role in the light-dependent reactions of photosynthesis, particularly in the transfer of electrons from water to plastoquinone in photosystem II (PSII). The recombinant form of this protein is produced through genetic engineering techniques, often in heterologous systems like Escherichia coli, to facilitate detailed biochemical and structural studies.

Structure and Function

The D1 protein is a transmembrane protein with a molecular weight of approximately 32 kDa. It is encoded by the psbA gene in cyanobacteria, with multiple isoforms (e.g., psbAI, psbAII, psbAIII) that are differentially expressed under varying light conditions . The structure of the D1 protein includes several transmembrane helices that are integral to the PSII complex, facilitating the binding of pigments and electron carriers necessary for electron transfer.

FeatureDescription
Molecular WeightApproximately 32 kDa
GenepsbA
FunctionElectron transfer in PSII
IsoformspsbAI, psbAII, psbAIII

Role in Photosynthesis

In photosynthesis, the D1 protein is central to the PSII reaction center, where it participates in the light-driven oxidation of water and the reduction of plastoquinone. This process involves the transfer of electrons from the manganese cluster (water-oxidizing complex) through the D1 protein to plastoquinone, ultimately contributing to the generation of ATP and NADPH.

Recombinant Production

Recombinant production of the D1 protein allows for the study of its structure and function in a controlled environment. This is typically achieved through expression in E. coli, where the protein is produced using in vitro systems . The recombinant protein can be used for biochemical assays, structural analysis, and biotechnological applications.

Research Findings

Recent studies have highlighted the importance of the D1 protein in responding to environmental stresses, such as high light intensity. The expression of different psbA isoforms is regulated by sensor kinases like NblS, which modulate gene expression in response to stress conditions . Understanding these mechanisms is crucial for improving photosynthetic efficiency and resilience in cyanobacteria.

Biotechnological Applications

Cyanobacteria like Synechococcus elongatus are being explored as bioreactors for the production of valuable compounds, including enzymes and biofuels . The ability to engineer and express recombinant proteins like the D1 protein in these organisms opens up possibilities for enhancing photosynthetic productivity and developing novel biotechnological applications.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific requests. Please indicate your preferred format in the order notes and we will strive to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional charges may apply.
Notes
Avoid repeated freezing and thawing. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference point.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
psbA1; psbA-I; Synpcc7942_0424; Photosystem II protein D1 1; PSII D1 protein 1; Photosystem II Q(B protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)
Target Names
psbA1
Target Protein Sequence
MTSILREQRRDNVWDRFCEWVTSTDNRIYVGWFGVLMIPTLLTATICFIVAFIAAPPVDI DGIREPVAGSLMYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLVVFHFL LGISCYMGRQWELSYRLGMRPWICVAYSAPLSAAFAVFLIYPIGQGSFSDGMPLGISGTF NFMFVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLGAWPVVGIWFTSMGISTMAFNLNGF NFNQSVLDSQGKVINTWADVLNRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It comprises a core antenna complex responsible for photon capture and an electron transfer chain that converts photonic excitation into a charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Photosystem Q(B) protein 1 and what is its role in Synechococcus elongatus?

Photosystem Q(B) protein 1, also known as the D1 protein, is encoded by the psbA1 gene in Synechococcus elongatus. It functions as a critical component of Photosystem II (PSII), serving as one of the core reaction center proteins. The D1 protein contains binding sites for essential cofactors involved in the water-splitting reaction and electron transport chain. In S. elongatus PCC 7942, there are two forms of D1 protein encoded by three genes (psbAI, psbAII, and psbAIII). The psbAI gene encodes D1 form I, which predominates under low light conditions, while psbAII and psbAIII encode D1 form II, which becomes more abundant when cells are exposed to high light conditions . This light-dependent expression pattern suggests that D1 form II may provide greater resistance to photooxidative damage, allowing the organism to adapt to varying light environments .

How does the structure of Photosystem Q(B) protein 1 relate to its function in photosynthesis?

The Photosystem Q(B) protein 1 (D1) contains multiple transmembrane α-helices that anchor it within the thylakoid membrane. The protein has a full sequence of 344 amino acids, with several functional domains that facilitate electron transport and quinone binding . The transmembrane regions create a scaffold that precisely positions cofactors including chlorophylls, pheophytins, and quinones at optimal distances and orientations for efficient electron transfer.

Molecular dynamics simulations have shown that the thermal movements of D1 and its associated proteins influence the efficiency of energy transfer within PSII. The relative positions of chromophores within the protein environment are critical for determining their excited-state energy levels or "colors" . Protein dynamics affect both structural and spectral factors that influence energy transfer and electron transport efficiency. When simulations combine molecular dynamics with quantum mechanical calculations of chromophore excited states, they can accurately predict the experimental absorbance spectrum of the PSII core complex, whereas calculations based solely on static X-ray structures cannot achieve this accuracy .

What are the spectral characteristics of Photosystem Q(B) protein 1, and how do they relate to its function?

The spectral properties of Photosystem Q(B) protein 1 are determined by its associated chlorophyll molecules and their protein environment. In photosystems, the Qy excitation energies of chlorophylls are particularly important for light absorption and energy transfer. Research on photosystem I in Synechococcus elongatus has demonstrated that the protein environment significantly modifies the excitation energies of chlorophylls compared to their energies in isolation .

The absorption spectrum of photosystem complexes can be predicted by constructing an effective Hamiltonian for chlorophyll Qy excitations, which takes into account both the intrinsic excitation energies of individual chlorophylls and the couplings between them . For closely positioned chlorophylls, these couplings must be calculated using quantum mechanical methods rather than simple dipole-dipole approximations. The protein environment creates subtle variations in chlorophyll excitation energies, which is critical for directing energy transfer toward the reaction center where charge separation occurs.

What are the optimal storage conditions for Recombinant Synechococcus elongatus Photosystem Q(B) protein 1?

Recombinant Synechococcus elongatus Photosystem Q(B) protein 1 requires careful storage to maintain its structural integrity and biological activity. Based on manufacturer recommendations, the protein should be stored at -20°C, and for extended storage, conservation at -20°C or -80°C is advised . For working solutions, store aliquots at 4°C for up to one week to minimize degradation.

The shelf life depends on multiple factors including storage state, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations maintain stability for approximately 6 months at -20°C/-80°C, while lyophilized preparations can remain stable for up to 12 months at the same temperatures . To maintain protein integrity, repeated freeze-thaw cycles should be strictly avoided as they can lead to protein denaturation and loss of function . Instead, prepare small working aliquots during initial thawing to reduce the need for multiple freeze-thaw events.

How can I verify the functional activity of recombinant Photosystem Q(B) protein 1 after expression?

Verifying the functional activity of recombinant Photosystem Q(B) protein 1 requires multiple complementary approaches:

  • Spectroscopic Analysis: Measure the absorption spectrum between 350-700 nm to verify characteristic chlorophyll absorption peaks. Active photosystem proteins show distinctive peaks at approximately 440 nm and 680 nm.

  • Fluorescence Measurements: Chlorophyll fluorescence emission at room temperature (primarily at 685 nm) and 77K (showing additional peaks at 695 nm) can indicate proper folding and pigment incorporation.

  • Oxygen Evolution Assays: When incorporated into liposomes or nanodiscs with other PSII components, active D1 protein should support oxygen evolution in the presence of artificial electron acceptors like ferricyanide.

  • Electron Transport Measurements: Using artificial electron donors and acceptors, measure the rate of electron transport through the recombinant protein complex using spectrophotometric methods.

  • Binding Assays: Verify binding of known inhibitors (such as DCMU or atrazine) that specifically target the QB binding pocket of D1, using isothermal titration calorimetry or similar techniques.

The combination of these methods provides comprehensive verification of both structural integrity and functional activity of the recombinant protein.

What expression systems are most effective for producing functional Recombinant Synechococcus elongatus Photosystem Q(B) protein 1?

For optimized expression in E. coli:

  • Use specialized E. coli strains (C41, C43, or Lemo21) designed for membrane protein expression

  • Express with an N-terminal 10xHis-tag for purification purposes

  • Include molecular chaperones (GroEL/GroES) to assist proper folding

  • Induce expression at lower temperatures (16-20°C) to reduce inclusion body formation

  • Use mild detergents (DDM, LMNG) for extraction and purification

Alternatively, homologous expression in Synechococcus elongatus PCC 7942 itself has shown promising results, particularly when:

  • Using native promoters like psbA2 that respond to stress conditions

  • Applying specific environmental conditions such as magnetic fields (30 mT) to enhance expression

  • Optimizing light conditions and media composition for photosynthetic growth

The choice between these systems depends on research goals: E. coli offers higher yield but may compromise function, while homologous expression generally provides better functional quality but lower yields.

How do the three psbA genes in Synechococcus elongatus respond differently to environmental conditions?

The three psbA genes in Synechococcus elongatus PCC 7942 exhibit distinct expression patterns in response to changing environmental conditions:

GeneProtein ProductLight Condition ResponseOther Environmental FactorsRegulatory Elements
psbAID1 form IDominant in low light, decreases in high lightDecreases under UV-A exposureContains non-consensus -35 element
psbAIID1 form IILow in low light, increases in high lightIncreases under UV-A and blue lightContains AU-rich sequences in 5' UTR
psbAIIID1 form IILow in low light, increases in high lightIncreases under UV-A and blue lightContains post-transcriptional regulatory elements

The light-responsive regulation is mediated by several factors. Notably, blue light specifically triggers increased accumulation of psbAII and psbAIII transcripts while decreasing psbAI transcript levels . This suggests that photoreceptors sensitive to specific light wavelengths participate in regulating D1 isoform expression.

Research with the nblS mutant has demonstrated that this sensor histidine kinase plays a crucial role in mediating the light-dependent expression of all three psbA genes. The nblS-1 mutant shows aberrant regulation, failing to increase psbAII and psbAIII transcripts or decrease psbAI transcripts in response to high light or UV-A irradiation . This indicates that nblS functions as a key regulator in the signaling pathway that controls the differential expression of D1 isoforms under varying light conditions.

What molecular dynamics approaches have been most informative for understanding Photosystem Q(B) protein function?

Molecular dynamics (MD) simulations have provided crucial insights into Photosystem Q(B) protein function by capturing its dynamic behavior in a native-like membrane environment. The most informative approaches include:

  • Full-System Embedded Simulations: Simulating the entire photosystem complex embedded in a realistic membrane environment with explicit solvent molecules has proven particularly valuable. For example, studies have modeled PSII core complex in its native membrane environment and generated molecular trajectories spanning nanoseconds . This approach revealed that while individual chromophore domains (reaction center, CP43, and CP47) maintain stable conformations (RMSD <0.6 Å), the relative positions between these domains change significantly over 4-6 ns . These subtle rearrangements significantly impact energy transfer pathways.

  • Combined MD/QM Methods: Integrating molecular dynamics with quantum mechanical (QM) calculations has been especially powerful. Time-dependent structures from MD simulations serve as input for QM calculations of chromophore excited states, revealing how protein dynamics influence the "color" of each chromophore and how those colors change over time . This approach successfully predicted the experimental absorbance spectrum of the PSII core complex, while calculations based solely on static X-ray structures failed to do so .

  • Cavity Filling Approaches: Advanced MD protocols addressing unassigned electron density in crystal structures have improved simulation accuracy. For instance, filling hydrophobic cavities between reaction centers and antenna domains with appropriate lipid molecules (similar to those found in homologous photosystem I structures) has been crucial for achieving stable, physiologically relevant simulations .

How do mutations in the psbA gene affect electron transport and photosynthetic efficiency?

Mutations in the psbA gene can significantly impact electron transport and photosynthetic efficiency through multiple mechanisms:

The nblS-1 mutant illustrates the complex regulatory networks controlling psbA gene expression. This mutant fails to properly regulate all three psbA genes in response to changing light conditions, showing little increase in psbAII and psbAIII transcript levels and no decrease in psbAI transcript level when exposed to high light or UV-A . This dysregulation likely contributes to the mutant's reduced ability to adapt to high light conditions and its non-bleaching phenotype under nutrient deprivation.

What are common challenges in purifying recombinant Photosystem Q(B) protein, and how can they be addressed?

Purifying recombinant Photosystem Q(B) protein presents several challenges due to its transmembrane nature and complex cofactor requirements. Common issues and solutions include:

ChallengeCauseSolution Strategies
Low solubilityHydrophobic transmembrane domainsUse specialized detergents (DDM, LMNG); Add glycerol (10-15%) to buffers; Employ amphipols for final stabilization
Poor yieldToxicity to expression host; Inclusion body formationUse specialized expression strains; Lower induction temperature (16-20°C); Consider cell-free expression systems
Protein aggregationImproper folding; Detergent mismatchScreen multiple detergents; Include stabilizing lipids; Use sucrose gradient ultracentrifugation to remove aggregates
Loss of cofactorsHarsh purification conditionsAdd chlorophyll derivatives to purification buffers; Minimize exposure to light; Include antioxidants (e.g., ascorbate)
HeterogeneityIncomplete translation; ProteolysisAdd protease inhibitors throughout purification; Use size exclusion chromatography as final step

For optimal purification of His-tagged recombinant Photosystem Q(B) protein:

  • Lyse cells in buffer containing 20 mM Tris-HCl (pH 7.5), 500 mM NaCl, 10% glycerol, 1% detergent, and protease inhibitors

  • Purify using immobilized metal affinity chromatography with imidazole gradient (20-250 mM)

  • Apply additional purification steps like ion exchange chromatography and size exclusion chromatography

  • Verify protein quality using SDS-PAGE, Western blotting, and activity assays

How can I optimize expression of recombinant Photosystem Q(B) protein in Synechococcus elongatus?

Optimizing expression of recombinant Photosystem Q(B) protein in Synechococcus elongatus requires careful consideration of multiple factors:

  • Promoter Selection: The psbA2 promoter has been demonstrated to be particularly effective for recombinant protein expression in S. elongatus PCC 7942, especially under stress conditions . This promoter responds to environmental changes, allowing regulated expression.

  • Environmental Stimulation: Application of a 30 mT magnetic field has been shown to significantly enhance recombinant protein expression under the psbA2 promoter without disrupting the electron transport chain . This approach increased transcription levels without negatively impacting photosynthetic machinery.

  • Light Conditions: Implementing specific light regimes can modulate expression levels. Since psbA genes respond differently to light intensity and quality, strategic light management (intensity, duration, and wavelength) can enhance expression of the recombinant protein.

  • Growth Phase Optimization: Harvesting cells at the optimal growth phase is critical. For psbA promoter-driven expression, mid-logarithmic growth phase typically yields the highest expression levels.

  • Media Composition: Modified BG-11 media with optimized nitrogen and phosphorus ratios can improve growth and protein expression. Supplementation with specific trace elements may further enhance expression levels.

  • Integration Site Selection: Careful selection of the genomic integration site influences expression stability and level. Neutral sites have been identified in the S. elongatus genome that allow stable integration without disrupting essential functions.

What analytical techniques are most effective for characterizing the structural dynamics of Photosystem Q(B) protein?

Multiple complementary analytical techniques provide insights into the structural dynamics of Photosystem Q(B) protein:

  • Time-Resolved Spectroscopy: Techniques such as ultrafast transient absorption spectroscopy and time-resolved fluorescence spectroscopy can track energy transfer and electron transport events in the femtosecond to millisecond time range, revealing the functional dynamics of the protein.

  • EPR Spectroscopy: Continuous wave and pulsed electron paramagnetic resonance spectroscopy can detect the formation of radical species during electron transport and determine distances between cofactors, providing information about structural changes during function.

  • Mass Spectrometry with H/D Exchange: This approach can identify regions of the protein that undergo conformational changes under different conditions by measuring the exchange rate of hydrogen atoms with deuterium from the solvent.

  • Cryo-Electron Microscopy: Recent advances in cryo-EM allow visualization of different conformational states of large protein complexes like photosystem II, potentially capturing the D1 protein in different functional states.

  • Molecular Dynamics Simulations: MD simulations complemented by quantum mechanical calculations have proven particularly valuable in understanding photosystem dynamics. These computational approaches have accurately predicted experimental absorption spectra and correctly assigned energy levels of reaction center chromophores . The methods have revealed how protein dynamics influence both structural and spectral factors affecting energy transfer and electron transport efficiency .

  • Cross-linking Mass Spectrometry: Chemical cross-linking combined with mass spectrometry can identify amino acids in close proximity in the native structure, providing constraints for modeling protein conformations and interactions.

For comprehensive characterization, these techniques should be used in combination, as each provides different yet complementary information about the structural dynamics of Photosystem Q(B) protein.

What are the most promising approaches for engineering Photosystem Q(B) protein to enhance photosynthetic efficiency?

Several promising approaches for engineering Photosystem Q(B) protein to enhance photosynthetic efficiency include:

How might insights from studying cyanobacterial Photosystem Q(B) protein inform the development of artificial photosynthetic systems?

Insights from cyanobacterial Photosystem Q(B) protein studies offer valuable guidance for developing artificial photosynthetic systems:

  • Cofactor Arrangement Principles: The precise spatial arrangement of electron transfer cofactors in D1 provides a blueprint for designing synthetic systems with efficient charge separation and reduced recombination. Molecular dynamics studies have revealed how thermal fluctuations in protein structure influence the efficiency of energy transfer within photosystem complexes , suggesting that dynamic flexibility should be incorporated into artificial systems.

  • Regulatory Adaptation Mechanisms: The differential expression of psbA genes in response to changing light conditions demonstrates natural strategies for maintaining optimal photosynthetic efficiency across environments. Artificial systems could incorporate similar adaptive responses, such as switchable components that optimize performance under varying conditions.

  • Repair and Regeneration Systems: The continuous turnover and repair of D1 protein in natural photosystems suggests that artificial systems might benefit from modular designs that allow damaged components to be replaced without dismantling the entire system.

  • Energy Transfer Optimization: Studies combining molecular dynamics with quantum mechanical calculations have shown how protein environments tune the energy levels of chlorophylls to create energy gradients that funnel excitation energy toward reaction centers . These principles can inform the design of artificial antenna systems with optimized energy transfer pathways.

  • Water-Splitting Catalysis: The catalytic site for water oxidation in PSII, which involves the D1 protein, remains the most efficient water-splitting catalyst known. Detailed understanding of its structure and mechanism provides inspiration for developing robust artificial catalysts for water oxidation.

What new technological developments are needed to better understand the structure-function relationship of Photosystem Q(B) protein?

Advancing our understanding of Photosystem Q(B) protein structure-function relationships requires several technological developments:

These technological advances would collectively enhance our ability to connect structural features of Photosystem Q(B) protein with its functional roles and regulatory mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.