Recombinant Synechococcus elongatus Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Key Residues and Their Roles

ResiduePositionFunctionSource Organism
Y26TM1Essential for catalysisE. coli
N146TM4Critical for substrate bindingE. coli
G154TM4Essential for membrane stabilityE. coli
R143, E151, R239, E243TM4-TM7Support catalytic activityE. coli

While Synechococcus elongatus Lgt has not been directly characterized, homology to E. coli and Synechocystis Lgt suggests conserved structural and functional features .

Recombinant Expression Systems

Recombinant Lgt is typically expressed in heterologous systems (e.g., E. coli) or engineered Synechococcus strains. Key tools include:

Expression Vectors

VectorPromoterTagsSelection MarkerApplication
pSyn6psbA1N-terminal 6His + TEV site; C-terminal V5-HisSpectinomycinHigh-level expression, purification, and detection
pETT7-dependentNoneAmpicillinInducible expression (e.g., nickel)

The pSyn6 vector is optimized for Synechococcus, enabling chromosomal integration and constitutive expression under the strong psbA1 promoter. Codon optimization is required due to the high GC content (~55.5%) of the Synechococcus genome .

Purification and Localization

  • Purification: N-terminal 6His tags enable nickel affinity chromatography, while V5 epitopes facilitate western blot detection .

  • Localization: Fusions to membrane proteins (e.g., Lgt-C-terminal tagging) target recombinant proteins to the cytoplasmic membrane .

Lipoprotein Biosynthesis Studies

Recombinant Lgt is used to study:

  1. Lipoprotein Maturation: Lgt catalyzes the transfer of diacylglyceryl groups to prolipoproteins, enabling membrane anchoring. In Synechocystis, Lgt-C-terminal fusions with thioesterases localized enzymes to the membrane for lipid metabolism studies .

  2. Membrane Biogenesis: Structural insights into Lgt’s role in maintaining membrane integrity, particularly in cyanobacteria with specialized lipid profiles .

Biotechnological Potential

  • Lipoprotein Engineering: Recombinant Lgt may enable production of modified lipoproteins for vaccine adjuvants or biofuel precursors.

  • Strain Optimization: Overexpression of Lgt in Synechococcus could enhance membrane protein stability, aiding industrial protein production .

Challenges and Future Directions

  • Codon Bias: High GC content in Synechococcus necessitates codon optimization for efficient heterologous expression .

  • Functional Validation: Limited data on Synechococcus Lgt necessitate comparative studies with E. coli and Synechocystis homologs .

  • Industrial Applications: Scalability of recombinant Lgt production in cyanobacterial bioreactors remains underexplored .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request as best as possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery time estimates.
Note: Our proteins are shipped standard with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
lgt; Synpcc7942_1230; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)
Target Names
lgt
Target Protein Sequence
MAIVTLLALQFTSPGPTLVEIGPLSIRWYGLLIASAVLLGISLSSRLARRRDIDPNAIAD LAVWLVIGAIPAARLYYVAFEWQQYASRPAEILAIWHGGIAIHGAILGGTAALILFARRR QIPIWQLTDVVVPSLALGQAIGRWGNFFNSEAFGTPTDLPWKLFIPIDRRPLAYIQSEYF HPTFLYESLWNLLLCLLLIWLFRQGLRQRLPLKAGVMTCIYLIGYSLGRIWIEGLRTDSL MLGSLRIAQMVSIVAIAFGVLGLVWIYGLKRSLPDVVRPAISGESRSEL
Uniprot No.

Target Background

Function
Prolipoprotein diacylglyceryl transferase (Lgt) catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This is the initial step in the maturation of lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Prolipoprotein diacylglyceryl transferase (lgt) and what is its function in Synechococcus elongatus?

Prolipoprotein diacylglyceryl transferase (lgt) is an enzyme that catalyzes the first step in the post-translational modification of bacterial lipoproteins. In Synechococcus elongatus, lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to the sulfhydryl group of the cysteine residue in the lipobox of prolipoproteins . This modification is essential for proper membrane anchoring of various proteins in this cyanobacterium. The enzyme is encoded by the lgt gene (locus tag Synpcc7942_1230) in the S. elongatus PCC 7942 genome and is classified with the Enzyme Commission number EC 2.4.99.- . The protein consists of 289 amino acids and plays a crucial role in maintaining the structural integrity of the bacterial membrane system.

What are the physical and biochemical properties of recombinant S. elongatus lgt protein?

The recombinant Synechococcus elongatus Prolipoprotein diacylglyceryl transferase is characterized by several key physical and biochemical properties important for research applications. The full-length protein (expression region 1-289) has the UniProt accession number Q31NV9 . The protein features a hydrophobic profile consistent with its function as a membrane-associated enzyme, containing multiple transmembrane domains as evident from its amino acid sequence. The recommended storage conditions include maintaining the protein in a Tris-based buffer with 50% glycerol at -20°C for regular storage or -80°C for extended preservation . For working solutions, aliquots should be stored at 4°C for no more than one week to maintain enzymatic activity . Repeated freeze-thaw cycles should be avoided as they can significantly diminish the protein's catalytic efficiency.

What are the optimal conditions for expressing recombinant S. elongatus lgt in heterologous systems?

The expression of recombinant Synechococcus elongatus lgt in heterologous systems requires careful optimization due to its membrane-associated nature. For bacterial expression systems, E. coli strains specifically designed for membrane protein expression (such as C41(DE3) or C43(DE3)) typically yield better results than standard laboratory strains . Expression should be conducted at lower temperatures (16-20°C) to minimize formation of inclusion bodies. The addition of specific membrane-mimicking detergents (0.5-1% n-dodecyl β-D-maltoside or similar) to lysis buffers is crucial for proper solubilization during protein extraction. For optimal yield, expression conditions should be fine-tuned with IPTG concentrations between 0.1-0.5 mM and induction times of 16-20 hours.

Table 1: Optimization Parameters for Heterologous Expression of S. elongatus lgt

ParameterRecommended RangeNotes
Expression HostE. coli C41(DE3), C43(DE3)Strains engineered for membrane proteins
Temperature16-20°CLower temperatures reduce inclusion body formation
IPTG Concentration0.1-0.5 mMStart with lower concentrations
Induction Time16-20 hoursExtended time improves folding
Detergent0.5-1% DDM or LDAOCritical for membrane protein solubilization

What purification strategies yield the highest activity for recombinant S. elongatus lgt?

Purification of recombinant S. elongatus lgt with preserved enzymatic activity requires a multi-step approach that maintains the protein's native conformation. The initial extraction should utilize a gentle detergent-based lysis method rather than sonication to preserve membrane-associated structures . An effective purification protocol typically begins with immobilized metal affinity chromatography (IMAC) using a histidine tag, followed by size exclusion chromatography to remove aggregates and impurities. Throughout the purification process, it is essential to maintain detergent concentrations above the critical micelle concentration to prevent protein aggregation. The choice of detergent is critical - n-dodecyl β-D-maltoside (DDM) at 0.03-0.05% in all buffers has shown good results for similar membrane enzymes. Activity assessments should be performed immediately after purification, as prolonged storage even under optimal conditions can lead to activity loss.

How can researchers overcome solubility challenges when working with S. elongatus lgt?

Addressing solubility challenges when working with S. elongatus lgt requires strategies tailored to membrane proteins. A systematic approach involves testing different detergent classes, including maltoside-based (DDM, DM), glucoside-based (OG), and zwitterionic detergents (LDAO, CHAPS) at varying concentrations . For recalcitrant preparations, detergent screening kits can identify optimal solubilization conditions. Alternative approaches include the use of amphipols or nanodiscs to stabilize the protein in solution without conventional detergents. Fusion partners such as MBP (maltose-binding protein) can significantly enhance solubility when added to the N-terminus with an appropriate linker sequence. For experimental applications requiring detergent-free environments, reconstitution into liposomes composed of E. coli polar lipids or synthetic lipid mixtures resembling cyanobacterial membranes can maintain the enzyme in a catalytically active state.

How can S. elongatus lgt be used to study lipoprotein processing pathways in cyanobacteria?

Recombinant S. elongatus lgt serves as a powerful tool for investigating lipoprotein processing pathways in cyanobacteria through several sophisticated approaches. In vitro reconstitution systems using purified lgt and fluorescently labeled peptide substrates containing the canonical lipobox motif enable real-time monitoring of diacylglyceryl transfer activity . For in vivo studies, researchers can employ knock-out/knock-in strategies in S. elongatus PCC 7942, leveraging its natural competence and homologous recombination capabilities to generate modified strains with tagged or mutated versions of lgt . Pulse-chase experiments with radiolabeled lipid precursors can track the incorporation of diacylglyceryl moieties into target proteins in these modified strains. To identify the complete lipoproteome dependent on lgt activity, comparative proteomic analysis between wild-type and lgt-deficient strains, coupled with metabolic labeling of lipoproteins using alkyne/azide-modified fatty acids and click chemistry, provides comprehensive insights into the breadth of substrates processed by this enzyme.

What are the implications of the SeAgo defense system for experiments involving recombinant lgt expression in S. elongatus?

The recently characterized Synechococcus elongatus Argonaute (SeAgo) defense system presents significant considerations for genetic manipulation experiments involving lgt. SeAgo functions as a DNA-guided nuclease that preferentially targets single-stranded DNA, providing defense against foreign genetic material . This defense mechanism directly impacts transformation efficiency when introducing recombinant lgt constructs into S. elongatus. Researchers should be aware that SeAgo has been identified as the highest negative determinant of natural transformation in genetic screens, with its activity characterized as a DNA-guided nuclease that preferentially targets single-stranded DNA with non-specific guide-independent activity on double-stranded DNA . For experimental designs involving lgt manipulation in S. elongatus, using an SeAgo deletion strain (Δago) can significantly improve transformation efficiency and enable the use of a broader range of expression vectors .

Table 2: Impact of SeAgo on Genetic Manipulation Methods in S. elongatus

MethodImpact of SeAgoRecommended Approach
Natural TransformationSignificant reduction in efficiencyUse Δago strains for higher transformation rates
Plasmid MaintenancePrevents RSF1010 replicon maintenanceUse Δago strains for plasmid-based expression
ConjugationMinimal effect observedStandard protocols sufficient
Genomic IntegrationReduced efficiency for ssDNATarget neutral sites with optimized constructs

How can researchers design experiments to investigate the role of lgt in cyanobacterial membrane dynamics and thylakoid formation?

Investigating the role of lgt in cyanobacterial membrane dynamics and thylakoid formation requires sophisticated experimental designs that account for the complex membrane architecture of Synechococcus elongatus. A comprehensive approach should begin with the generation of conditional lgt mutants using inducible promoter systems, as complete knockouts may be lethal if the enzyme is essential . Time-resolved confocal and electron microscopy analyses of these mutants during lgt depletion can reveal structural changes in membrane organization. Researchers should complement imaging data with lipidomic and proteomic profiling to identify specific lipid-protein interactions disrupted by lgt deficiency. For mechanistic insights, in vitro reconstitution experiments using purified lgt and synthetic membrane systems can demonstrate direct effects on membrane properties such as fluidity, curvature, and domain formation.

What contradictions exist in the current data regarding S. elongatus lgt function, and how might researchers address these?

Current research on S. elongatus lgt contains several unresolved contradictions that merit further investigation. One significant discrepancy involves the predicted enzyme classification (EC 2.4.99.-) which suggests glycosyltransferase activity, while the functional characterization clearly indicates lipid transfer activity . This classification inconsistency should be addressed through detailed biochemical characterization using purified enzyme with multiple substrate classes. Another contradiction concerns the subcellular localization of lgt in S. elongatus - whether it functions exclusively in the cytoplasmic membrane or also in thylakoid membranes remains unclear. Researchers can address this through immunogold electron microscopy with specific anti-lgt antibodies or by creating fluorescently tagged lgt variants for live-cell imaging. Additionally, contradictory reports exist regarding the essentiality of lgt in cyanobacteria. To resolve this, CRISPR interference (CRISPRi) approaches allowing titratable repression of lgt expression would help determine the minimum threshold required for viability.

How is the lgt gene organized within the Synechococcus elongatus genome, and what can this tell us about its regulation?

The lgt gene in Synechococcus elongatus PCC 7942 is identified by the locus tag Synpcc7942_1230 within the genomic context of this model cyanobacterium . Genomic organization analysis reveals insights into its potential regulation and evolutionary significance. The gene appears to be part of a transcriptional unit related to membrane biogenesis, suggesting coordinated expression with other genes involved in membrane protein processing. Examination of the promoter region shows putative binding sites for general transcription factors associated with housekeeping functions, consistent with the essential nature of lipoprotein processing . The lgt gene is maintained across all sequenced strains of S. elongatus, including the closely related PCC 6301, PCC 6311, PCC 7942, PCC 7943, and UTEX 2973, indicating its core function in cyanobacterial physiology .

What evolutionary insights can be gained from comparing lgt across different Synechococcus elongatus strains?

Comparative genomic analysis of lgt across different Synechococcus elongatus strains provides valuable evolutionary insights into this essential enzyme. The lgt gene is part of the core genome maintained across all sequenced S. elongatus strains, including PCC 6301, PCC 6311, PCC 7942, PCC 7943, and UTEX 2973 . Sequence conservation analysis indicates that lgt has undergone purifying selection, with minimal non-synonymous substitutions between strains, highlighting its fundamental importance to cellular function. This conservation extends beyond just the coding sequence to include the upstream regulatory elements, suggesting evolutionary pressure to maintain not only the protein structure but also its expression patterns. When placed in the broader context of the Synechococcus-Prochlorococcus clade, S. elongatus lgt forms part of a monophyletic group that clusters separately from other Synechococcus species .

What are common technical challenges when working with recombinant S. elongatus lgt and how can they be addressed?

Researchers working with recombinant Synechococcus elongatus lgt frequently encounter several technical challenges that require specific troubleshooting approaches. Protein aggregation during expression and purification represents a major obstacle due to the hydrophobic nature of this membrane-associated enzyme . This can be addressed by optimizing detergent composition and concentration throughout the purification process, with a systematic screening of detergent types (maltoside, glucoside, and zwitterionic classes). Low expression yields are another common issue, which can be improved by using specialized expression hosts designed for membrane proteins and optimizing induction conditions (lower temperatures, reduced inducer concentrations, extended expression times). Maintaining enzymatic activity post-purification often proves challenging; this can be mitigated by minimizing exposure to air oxidation by including reducing agents in all buffers and working under nitrogen atmosphere when possible.

How can researchers validate the activity of purified recombinant S. elongatus lgt?

Validating the enzymatic activity of purified recombinant S. elongatus lgt requires specialized assays that accommodate its membrane-associated nature and specific catalytic function. A definitive activity assay involves monitoring the transfer of radiolabeled diacylglyceryl from phosphatidylglycerol to a synthetic peptide substrate containing the lipobox motif . For non-radioactive alternatives, researchers can employ fluorescently labeled lipid analogs coupled with thin-layer chromatography (TLC) or HPLC separation to track product formation. Mass spectrometry-based approaches provide the most detailed validation by directly identifying the mass shift corresponding to diacylglyceryl addition on substrate peptides. To ensure physiological relevance, activity assays should be conducted at temperatures reflective of the cyanobacterial growth environment (30-35°C) and at pH values consistent with the cellular compartment where lgt functions (typically pH 7.0-8.0).

Table 3: Activity Assay Methods for S. elongatus lgt

Assay MethodPrincipleAdvantagesLimitations
Radiolabeled Lipid TransferMeasuring transfer of 14C-labeled lipids to peptide substratesHigh sensitivity, direct quantificationRequires radioactive materials, specialized facilities
Fluorescent Lipid AnalogsUsing fluorescent lipid donors and monitoring transferNo radioactivity, real-time monitoringPotential artifact from fluorophore interference
Mass SpectrometryDirect detection of modified peptidesUnambiguous product identificationRequires specialized equipment, not real-time
FRET-based AssaysEnergy transfer between labeled substrate and productReal-time kinetics, high-throughput potentialComplex assay development, potential false signals

What strategies can improve reproducibility when studying S. elongatus lgt in different research settings?

Ensuring reproducibility when studying S. elongatus lgt across different research settings requires systematic standardization of multiple experimental parameters. First, researchers should precisely document the strain of Synechococcus elongatus used, as the search results indicate multiple strains exist with varying genetic characteristics . For recombinant protein work, standardization should include the expression construct design (tag position, linker sequences), expression conditions (host strain, media composition, induction parameters), and purification protocols (detergent type and concentration, buffer composition) . Activity assays should specify substrate concentrations, reaction times, temperature, and detection methods with clear threshold criteria for positive results. For genetic manipulation experiments, the transformation method should be detailed, accounting for the significant impact of the SeAgo defense system on transformation efficiency .

How does research on S. elongatus lgt contribute to understanding photosynthetic membrane biogenesis?

Research on Synechococcus elongatus lgt provides critical insights into photosynthetic membrane biogenesis through its role in lipoprotein processing within this model cyanobacterium. As a key enzyme catalyzing the first step in lipoprotein maturation, lgt directly influences the composition and organization of both plasma membrane and thylakoid membrane systems unique to photosynthetic organisms . The proper anchoring of lipoproteins facilitated by lgt activity affects membrane curvature, fusion, and compartmentalization - all crucial processes in thylakoid membrane formation and maintenance. These lipoproteins often function as structural scaffolds that organize photosynthetic complexes within the thylakoid membrane, directly impacting photosynthetic efficiency. Understanding the specificity of S. elongatus lgt for different substrate proteins can reveal how essential photosynthetic components are targeted to their proper membrane destinations.

What insights from S. elongatus lgt research can be applied to circadian rhythm studies in cyanobacteria?

The study of Synechococcus elongatus lgt intersects with circadian rhythm research through several mechanistic connections in this model cyanobacterium. S. elongatus PCC 7942 is well-established as a "cyanobacterial model organism used for research in prokaryotic photosynthesis and circadian rhythms" . The circadian clock in cyanobacteria relies on the proper localization and function of key proteins including KaiA, KaiB, and KaiC, some of which may require membrane association for optimal function. Lgt-mediated lipid modifications could play a regulatory role in the temporal organization of these clock components. Researchers have noted a "perplexing SNP in rpaA, the master regulator output of the circadian clock," suggesting potential interplay between membrane-associated processes and circadian regulation . By investigating whether clock-related proteins undergo lgt-dependent modifications, researchers can uncover novel regulatory mechanisms linking membrane dynamics to circadian timing.

How can insights from S. elongatus genetic manipulation systems inform lgt research methodologies?

Recent advances in Synechococcus elongatus genetic manipulation systems provide valuable methodological insights for lgt research. The discovery that SeAgo functions as a defense system against foreign DNA with significant impact on transformation efficiency directly informs experimental design when manipulating the lgt gene . Researchers should consider using SeAgo-deficient strains for higher transformation efficiency, especially when studying lgt through genetic approaches. The knowledge that "deletion of the ago gene facilitates genetic studies and genetic engineering of S. elongatus" provides a practical solution for improving experimental outcomes . Additionally, the established neutral sites (NS1, NS2, and NS3) in the S. elongatus genome offer strategic integration locations for lgt variants with minimal interference from native regulatory networks . These genetic tools enable precise manipulation of lgt expression levels, subcellular localization, and interaction partners to elucidate its functional roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.