Recombinant Synechococcus sp. Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Description

Molecular and Biochemical Characteristics

Apocytochrome f, a 325 amino acid protein, includes a 42 amino acid presequence and a heme-binding domain with a conserved CANCH motif . The cytochrome b6-f complex, of which apocytochrome f is a part, mediates electron transfer and cyclic electron flow .

Gene Expression and Regulation

The expression of the petA gene is influenced by environmental factors and cellular conditions. For example, in Synechococcus sp. strain PCC7002, the mRNA level of petA increases under certain stress conditions . Specifically, when a mutant strain (Δ sqr) lacking sulfide:quinone oxidoreductase (SQR) was studied, the petA transcript levels increased by 1.8-fold compared to the wild type . This indicates that petA expression is responsive to changes in sulfur metabolism and redox balance within the cell .

Role in Photosynthesis and Electron Transfer

Apocytochrome f is a critical component of the cytochrome b6-f complex, which links PSII and PSI in the photosynthetic electron transport chain. This complex oxidizes plastoquinol and reduces plastocyanin, contributing to the proton gradient across the thylakoid membrane that drives ATP synthesis .

Stress Response and Nutrient Acclimation

The FtsH1/3 proteolytic complex, crucial for nutrient stress acclimation in Synechocystis, affects the expression of genes involved in iron, phosphate, carbon, and nitrogen metabolism . Although the provided text does not directly link FtsH1/3 to petA, it establishes the importance of proteolytic complexes in modulating gene expression under nutrient-deprived conditions, which can indirectly influence photosynthetic genes .

Recombinant Production and Applications

Recombinant apocytochrome f can be produced in various expression systems, allowing for detailed biochemical and structural studies. For example, recombinant Synechococcus elongatus Apocytochrome f(petA) is available for research purposes . Additionally, ELISA kits for Recombinant Synechococcus sp. Apocytochrome f(petA) are also available, which indicates its potential use in protein quantification and immunological studies .

Mutant Studies and Complementation

Studies involving mutant strains of Synechococcus provide insights into the function of apocytochrome f. For instance, the Δ sqr mutant of Synechococcus sp. PCC7002 showed increased expression of petA, suggesting a compensatory mechanism in response to altered sulfur metabolism .

Comparative Studies

Comparative studies of different Synechocystis strains, including those with heterologous gene insertions, often involve monitoring the expression of petA as a control . For example, in metabolic engineering studies, petA transcription is examined to verify the quality of RNA samples and the success of gene transcription .

The following table summarizes the effects of various factors on petA expression and function based on the analyzed documents.

Condition/FactorEffect on petA Expression/FunctionReference
Δ sqr mutant (SQR deficiency)1.8-fold increase in petA mRNA level
Iron depletionGenerally induces genes related to iron transport
Heterologous gene insertionpetA used as a positive control for transcription in engineered strains
CCS5 mutationInteracts with apocytochrome f, affecting thylakoid lumen formation

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; CYA_1404; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-327
Protein Length
Full Length of Mature Protein
Species
Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime)
Target Names
petA
Target Protein Sequence
YPYYAQMAYDNPREATGKIVCANCHLNAMPARAEVPQAVTPGQVFTIKVGIPYDLSKQQV LADGSKGGLNVGAVVVLPEGFRLATEEEMTEEQRQETAETYITPYSDEKPNILLVGPLPG EQHQEIVFPVVAPDPKEDPSVAFMKYRVYIGANRGRGQINPDGSLSNNNVFRAPATGRLT SIATIESDLSDLPPELAALVPPEYELPGTRVLSFETEGGLKHLVVPPGPELVVNIGDSVQ EGDPVTNNPNVGGFGQVERDLVLQNPERVKWLVAFLAAVAITQLLLVLKKKQVELIQAAE LLG
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Database Links
Protein Families
Cytochrome f family
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is the gene structure of petA in Synechococcus sp.?

The petA gene in Synechococcus sp. PCC 7002 is organized in a single operon (petCA) alongside the gene encoding the Rieske iron-sulfur protein (petC). This genomic organization facilitates coordinated expression of these functionally related components of the photosynthetic electron transport chain. Sequence analysis has confirmed that petA encodes the apocytochrome f precursor, which is a critical component of the cytochrome b6f complex involved in photosynthetic electron transport .

What are the key structural features of Synechococcus apocytochrome f?

Synechococcus sp. PCC 7002 apocytochrome f consists of 325 amino acids with several distinctive structural domains:

These features distinguish cyanobacterial cytochrome f from higher plant chloroplast homologs and are critical for its function in electron transport .

Structural FeatureLocation (amino acid position)Function
Presequence1-42Protein targeting and processing
CANCH motif20-24 (from mature protein start)Heme binding
Membrane-spanning domain250-269Membrane anchoring

How conserved is petA across cyanobacterial species?

Comparative sequence analysis shows that the mature cytochrome f from Synechococcus sp. PCC 7002 shares 71.5% sequence identity with Nostoc PCC 7906 cytochrome f, indicating substantial conservation of this protein across diverse cyanobacterial species. Nine separate domains showing differences in charged residues between cyanobacteria and plants have been identified, which may be involved in species-specific ionic interactions with electron transport partners such as plastocyanin or cytochrome c-553 .

What expression systems are most effective for recombinant petA expression in cyanobacteria?

The pET expression system has been successfully adapted for cyanobacterial hosts, allowing efficient expression of heterologous genes in Synechococcus. This system employs bacteriophage T7 RNA polymerase under the control of an inducible promoter, such as a nickel-inducible promoter. The T7 RNA polymerase binds with high specificity to the T7 promoter (PT7), driving targeted transcription of the heterologous gene cloned downstream of this promoter .

Key advantages of this system include:

  • Controlled expression triggered only when desired

  • High specificity of the T7 RNA polymerase for its cognate promoter

  • Strong transcription rates leading to increased protein yields

  • Potential for more than 50% conversion of atmospheric CO₂ to recombinant protein biomass

For successful transformation, integrative vectors are preferable to replicative vectors as they ensure gene stability through recombination, supporting long-term maintenance of the transgenic lineage .

What are the critical considerations for genomic integration of recombinant petA?

When integrating recombinant petA into the Synechococcus genome, researchers should consider:

  • Integration site selection: Neutral genomic loci such as Synpcc7942_0741 (Phage tail protein I gene region) have been successfully used as integration sites that minimize disruption of essential functions .

  • Selection markers: Antibiotic resistance genes like chloramphenicol resistance (cmlR) are effective for selecting transformed cells.

  • Confirmation of integration: PCR validation using primers that span the integration junction is essential, typically generating specific fragment sizes (e.g., 1.8-kb) that confirm successful integration .

  • Strain variation awareness: Genomic differences between Synechococcus strains can affect transformation efficiency and expression levels. For example, PCC 7942 has a mutation in pilN, which is necessary for natural transformation, explaining differences in transformability between strains .

How can researchers optimize expression levels of recombinant petA?

Optimizing recombinant petA expression requires careful consideration of several factors:

  • Promoter selection: Inducible promoters such as nickel-responsive elements provide temporal control over expression. Induction conditions should be optimized for each specific construct.

  • Codon optimization: Adjusting codon usage to match the preferences of Synechococcus can significantly improve expression efficiency.

  • Growth conditions: Photosynthetic activity directly impacts cellular metabolism and protein production capacity. Light intensity, CO₂ concentration, and nutrient availability should be systematically optimized.

  • Expression timing: Expression levels of photosynthetic components like petA naturally fluctuate in response to environmental conditions. In the Δsqr mutant of Synechococcus sp. PCC7002, petA mRNA levels increased 1.8-fold compared to the wild type, suggesting that cellular redox state influences expression . This knowledge can be leveraged when designing expression strategies.

What methods are effective for detecting and quantifying recombinant apocytochrome f expression?

Multiple complementary approaches can be used to assess recombinant apocytochrome f expression:

  • Transcriptional analysis: RT-qPCR using primers specific to the recombinant petA sequence can quantify mRNA levels, similar to methods used to detect a 1.8-fold increase in petA mRNA in the Δsqr mutant .

  • Protein detection: Western blotting using antibodies against apocytochrome f or epitope tags is effective for detecting the protein product.

  • Functional assays: Measuring electron transport activity through the cytochrome b6f complex using artificial electron donors/acceptors or polarographic methods.

  • Spectroscopic analysis: The characteristic absorption spectrum of the heme group in mature cytochrome f provides a means for specific detection and quantification.

How can recombinant petA mutations inform our understanding of photosynthetic electron transport?

Strategic mutations in recombinant petA can provide valuable insights into electron transport mechanisms:

  • Heme-binding domain mutations: Altering the conserved CANCH motif can help elucidate the precise role of the heme group in electron transfer.

  • Charged residue substitutions: The nine domains with differential charge distributions between cyanobacteria and plants can be mutated to investigate their role in interactions with electron transport partners .

  • Membrane-spanning domain modifications: Changes to the hydrophobic region (residues 250-269) can reveal the importance of membrane localization and orientation for function.

  • Comparative mutational analysis: Creating mutations that convert cyanobacterial-specific features to plant-like characteristics can help understand evolutionary adaptations in photosynthetic machinery.

What are the potential biotechnological applications of engineered Synechococcus expressing modified petA?

Recombinant Synechococcus with engineered petA can serve various biotechnological purposes:

How do genomic differences between Synechococcus strains affect recombinant petA expression?

Genomic analysis reveals important strain differences that can impact recombinant protein expression:

  • Laboratory domestication effects: Early laboratory domestication of strains has led to genetic divergence, even between closely related strains like PCC 6301 and PCC 7942 .

  • Natural competence variations: Some strains like PCC 7942 entered laboratories as genetically tractable models due to differences in genes required for natural competence, such as pilN .

  • Prophage regions: Differences in large prophage regions between strains can influence phenotypic characteristics and potentially affect recombinant protein expression .

  • Single nucleotide polymorphisms: SNPs can have significant effects on phenotypes ranging from pigmentation to gene expression patterns, which may impact recombinant protein production .

What criteria should guide Synechococcus strain selection for recombinant petA expression?

When selecting a Synechococcus strain for recombinant petA expression, researchers should consider:

  • Genetic tractability: Strains with established transformation protocols such as PCC 7942 or PCC 7002 offer technical advantages.

  • Growth characteristics: Fast-growing strains like UTEX 2973 may allow for more rapid protein production cycles.

  • Genomic stability: Strains with fewer mobile genetic elements may provide more stable expression over multiple generations.

  • Environmental tolerance: Depending on intended application conditions, strains with appropriate temperature, light, or salinity tolerance should be selected.

  • Comparative genomic information: Understanding the phylogenetic relationships between strains can inform expectations about genetic compatibility and expression patterns .

What emerging technologies might enhance recombinant petA research?

Several advanced approaches show promise for future research:

  • CRISPR-Cas9 genome editing: Precise modification of petA and related genes could enable more sophisticated functional studies.

  • Synthetic biology approaches: De novo design of optimized petA variants could enhance photosynthetic efficiency or create novel functions.

  • Advanced imaging techniques: Cryo-electron microscopy and super-resolution microscopy could provide insights into the structural integration of recombinant apocytochrome f.

  • Systems biology integration: Combining transcriptomics, proteomics, and metabolomics approaches could reveal the broader impacts of petA modification on cellular physiology.

  • Ecological studies: Understanding how petA sequence variations contribute to niche adaptation across the diversity of marine Synechococcus clades could inform biotechnological applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.