Recombinant Synechococcus sp. Apolipoprotein N-acyltransferase (lnt)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Synechococcus sp. Apolipoprotein N-acyltransferase (lnt)

Recombinant Synechococcus sp. Apolipoprotein N-acyltransferase (lnt) is a recombinant protein derived from the cyanobacterium Synechococcus sp. This enzyme plays a crucial role in the maturation of lipoproteins by catalyzing the N-acylation of the N-terminal cysteine residue. The recombinant form of this enzyme is typically expressed in Escherichia coli and is used for research purposes.

Characteristics of Recombinant Synechococcus sp. Apolipoprotein N-acyltransferase (lnt)

  • Species: Synechococcus sp.

  • Source: Expressed in E. coli.

  • Tag: N-terminal His tag.

  • Protein Length: Full-length, spanning 1-465 amino acids.

  • Form: Lyophilized powder.

  • Purity: Greater than 90% as determined by SDS-PAGE.

  • Storage: Store at -20°C or -80°C upon receipt. Avoid repeated freeze-thaw cycles.

SpecificationDescription
SpeciesSynechococcus sp.
SourceE. coli
TagN-terminal His tag
Protein LengthFull-length (1-465aa)
FormLyophilized powder
Purity>90% by SDS-PAGE
Storage-20°C or -80°C

Function and Mechanism

Apolipoprotein N-acyltransferase (lnt) belongs to the nitrilase superfamily and catalyzes the attachment of a fatty acid to the alpha-amino group of the N-terminal cysteine of apolipoproteins. This process occurs through a two-step ping-pong mechanism, where the first step involves the acyl transfer from a phospholipid substrate to form a thioester linkage on the active site cysteine. The second step involves the transfer of the acyl chain from this cysteine to the N-terminal cysteine of the apolipoprotein, resulting in the final mature lipoprotein .

Applications and Significance

Recombinant Synechococcus sp. Apolipoprotein N-acyltransferase (lnt) is used in research to study lipoprotein maturation and its implications in bacterial physiology. Understanding the mechanisms of lnt can provide insights into bacterial virulence and potential therapeutic targets. Additionally, the enzyme's role in lipid modification makes it relevant for studies on bacterial membrane structure and function.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
lnt; SYNW1623; Apolipoprotein N-acyltransferase; ALP N-acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-465
Protein Length
full length protein
Species
Synechococcus sp. (strain WH8102)
Target Names
lnt
Target Protein Sequence
MGDLRSQPLLRAVLGGLLAGLAPGVAGPLSMLPALALLWSLVERPRDAALWGLFGVLLSH RWLLGLHPLTWMGLPAWLSLPVAVAIWLSCGVAAALLLLLWSLLARLCRRRDGTWRFGAV LLLALVWGAAELLLEGSPLFWIGVGGSVLPLDRPLAGLGRWLGSGGLATLQLLWGWGLWQ LWRRRGRRCAWWLISLLLAHAMGALSLSPPPALAALRLGAWQPAIPTREKFSPERQRRFQ SALSSALQQAQSLKVEALVAPEGTLPFRWQADEDPLPVPLISGGFRWVRGQQRSSVLLAR PDRAGVEPLVDKHRLVPLGEWLPPLPAGLTRGLSAVGGLQPGDASRFVNVWPSPFAVAIC YEISDGRALAKATAQGAEWLLTIANLDPYPQLLQRQFLALAQLRAIETGRDVLSVANTGP TALVSADGTVQRLLEPQTDAVAAAELQRRQQLTGYSRLVWAWSSR
Uniprot No.

Target Background

Function
This enzyme catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoprotein, representing the final step in lipoprotein maturation.
Database Links
Protein Families
CN hydrolase family, Apolipoprotein N-acyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Apolipoprotein N-acyltransferase (Lnt) and what is its function in bacteria?

Apolipoprotein N-acyltransferase (Lnt) is an integral membrane protein that catalyzes the final step in post-translational modification of bacterial lipoproteins. Its primary function involves transferring an acyl chain from a phospholipid to the α-amino group of the N-terminal diacylglyceryl-modified cysteine of apolipoprotein, resulting in a mature triacylated lipoprotein . The enzyme undergoes a two-step reaction mechanism: first forming a thioester acyl-enzyme intermediate with the phospholipid donor, then transferring this acyl group to the apolipoprotein substrate . This modification is essential for proper lipoprotein function in bacterial cell envelopes.

Why is Synechococcus sp. considered an effective expression system for recombinant proteins like Lnt?

Synechococcus sp., particularly Synechococcus elongatus PCC 7942, offers several advantages as an expression system for recombinant proteins, including membrane proteins like Lnt:

  • It possesses a small genome (2.7 Mb) that is easily manipulated through natural transformation .

  • The system enables high-level protein expression, with recombinant proteins representing >10% of total soluble protein using optimized vectors .

  • It allows targeted integration of genes into the genome with >80% integration efficiency .

  • The organism can be cultivated in simple media like BG-11 with minimal requirements .

  • Modern Synechococcus strains demonstrate high compatibility with advanced genetic tools like CRISPR-Cas12a, with single insertion efficiencies of 31-81% .

  • As a photosynthetic organism, it offers economic advantages for large-scale protein production.

What are the key experimental differences between working with Lnt in its native bacterial context versus as a recombinant protein?

Working with recombinant Lnt in Synechococcus sp. presents several key differences compared to studying the native enzyme:

  • Membrane environment differences: Lnt activity is strongly affected by phospholipid headgroup and acyl chain composition . Synechococcus membranes have a different composition than those of bacteria where Lnt naturally functions.

  • Expression optimization challenges: Membrane protein overexpression can cause toxicity and improper folding, requiring careful optimization of expression conditions.

  • Purification considerations: Extracting recombinant Lnt while maintaining its native conformation requires specialized detergents and techniques that differ from those used with native Lnt.

  • Activity assessment: Kinetic parameters and substrate preferences may differ between native and recombinant Lnt due to the expression environment, necessitating careful comparative studies.

  • Post-translational modifications: Potential differences in post-translational modifications between host systems may affect enzymatic function.

How should I design an expression system for recombinant Lnt in Synechococcus sp.?

An optimized expression system for recombinant Lnt in Synechococcus sp. should include the following components:

Vector design:

  • Utilize a strong constitutive promoter such as psbA1 for robust expression

  • Incorporate an optimized ribosome binding site (RBS) to enhance translation efficiency

  • Include purification tags such as N-terminal 6His-TEV and/or C-terminal V5-His epitope tags

  • Target integration into validated neutral sites to prevent disruption of essential functions

Selection strategy:

  • Implement spectinomycin resistance (25 μg/mL) as the preferred selection marker, as Synechococcus shows robust susceptibility to this antibiotic

  • Consider alternative markers if needed: kanamycin (100 μg/mL), gentamicin (50 μg/mL), erythromycin (1.25 μg/mL), or chloramphenicol (5 μg/mL)

Integration approach:

  • Use natural transformation for genomic integration with expectation of >80% integration efficiency

  • For membrane proteins like Lnt, consider lower expression temperatures to improve proper folding

  • If initial expression attempts show toxicity, implement inducible systems like the DAPG-inducible PhlF repressor system

What purification strategy is most effective for obtaining active recombinant Lnt from Synechococcus sp.?

Purifying active recombinant Lnt from Synechococcus sp. requires a specialized approach due to its membrane-embedded nature:

Membrane preparation:

  • Harvest Synechococcus cells expressing recombinant Lnt (typically 3-5 days post-transformation)

  • Disrupt cells using methods compatible with cyanobacteria (sonication or bead-beating)

  • Isolate membrane fractions through differential centrifugation

  • Wash membranes to remove peripheral proteins

Membrane protein solubilization:

  • Solubilize membranes using mild detergents (n-dodecyl-β-D-maltoside or digitonin)

  • Maintain phospholipids in the solubilization buffer, as they affect Lnt activity

  • Remove insoluble material by high-speed centrifugation

Affinity purification:

  • Utilize the N-terminal 6His-TEV tag for initial capture on Ni-NTA resin

  • Include appropriate detergent in all buffers to maintain protein solubility

  • Elute using imidazole gradient (50-300 mM)

  • If higher purity is required, use the C-terminal V5-His tag for secondary purification

Activity preservation:

  • Include phosphatidylethanolamine in purification buffers, as it serves as a preferred acyl donor

  • Consider reconstitution into liposomes or nanodiscs for activity studies

  • Store with glycerol (10%) and reducing agent to preserve the catalytic cysteine

How can I quantitatively measure the enzymatic activity of recombinant Lnt in vitro?

Based on published methodologies, a robust mixed micelle assay can effectively measure recombinant Lnt activity :

Assay components:

  • Purified recombinant Lnt (typically 0.1-1 μM)

  • Phospholipid acyl donors (preferably phosphatidylethanolamine)

  • Synthetic diacylglyceryl-modified lipopeptide substrate (e.g., FSL-1)

  • Detergent system (Triton X-100 or similar)

  • Buffer system (pH 7.4-8.0)

Reaction setup:

  • Prepare mixed micelles containing phospholipids and detergent

  • Add purified Lnt enzyme

  • Initiate reaction by adding the lipopeptide substrate

  • Incubate at 30°C for defined time periods

Detection methods:

  • Radiochemical detection: Use [(3)H]palmitate-labeled phospholipids and measure incorporation into the lipopeptide substrate

  • Mass spectrometry: Analyze reaction products by LC-MS/MS to detect acylated products

  • HPLC analysis: Separate and quantify reaction products based on hydrophobicity changes

Kinetic analysis:

  • Determine initial velocities at varying substrate concentrations

  • Calculate Km and Vmax values for both the phospholipid donor and lipopeptide substrate

  • Analyze data according to a ping-pong mechanism model

What control experiments are essential when characterizing recombinant Lnt from Synechococcus sp.?

When characterizing recombinant Lnt, the following controls are essential to ensure reliable and interpretable results:

Expression and purification controls:

  • Western blot analysis with anti-His or anti-V5 antibodies to confirm expression and size

  • Empty vector control to validate specificity of detection

  • Membrane fractionation to confirm proper localization

  • Size exclusion chromatography to assess oligomeric state and homogeneity

Activity assay controls:

  • Catalytic cysteine mutant (C→A/S) to confirm thioester mechanism

  • Heat-inactivated enzyme control to verify enzyme-dependent activity

  • No-enzyme and no-substrate controls to establish baseline

  • Time-course sampling to ensure measurements in the linear range

  • Enzyme concentration series to confirm proportional activity

Substrate specificity controls:

  • Various phospholipid donors to confirm headgroup preferences

  • Different lipopeptide substrates to assess substrate recognition

  • Competition assays to verify specific binding

Data validation:

  • Multiple independent protein preparations to ensure reproducibility

  • Alternative assay methods to confirm results (e.g., radiolabeling and mass spectrometry)

  • Positive control with a known Lnt enzyme (e.g., from E. coli) when possible

How does phospholipid composition affect the activity of recombinant Lnt from Synechococcus sp.?

The phospholipid environment critically influences Lnt activity, with significant implications for recombinant expression:

Headgroup specificity:
Studies have demonstrated that "N-acyltransferase activity was strongly affected by the phospholipid headgroup and acyl chain composition" . This presents a challenge for recombinant expression in Synechococcus sp., whose membrane composition differs from bacteria where Lnt naturally occurs.

Acyl chain preferences:
Lnt demonstrates preferences for specific acyl chain lengths and saturation levels as donors for the acylation reaction. The natural phospholipid composition of Synechococcus membranes may provide suboptimal acyl donors, potentially affecting enzymatic efficiency.

Experimental approaches to address this issue:

ApproachMethodologyExpected Outcome
Phospholipid profilingLipidomics analysis of Synechococcus membranes vs. native Lnt hostIdentification of compositional differences
Donor screeningTest activity with various purified phospholipidsDetermination of optimal acyl donors
Membrane engineeringExpress phospholipid synthesis enzymes to modify compositionCreation of more favorable lipid environment
Reconstitution studiesCompare activity in different membrane mimetic systemsOptimization of in vitro reaction conditions

This understanding is crucial for accurate comparison between native and recombinant Lnt and for optimizing expression systems.

How can CRISPR-Cas12a technology be leveraged to optimize Lnt expression in Synechococcus sp.?

CRISPR-Cas12a offers powerful approaches for optimizing Lnt expression in Synechococcus sp., with several strategic applications:

Precise genomic integration:
Synechococcus sp. strains show high efficiency with CRISPR-Cas12a genome editing (31-81% for single insertions) . This precision can be used to integrate the lnt gene at optimal genomic locations that balance expression with minimal physiological disruption.

Promoter optimization:
CRISPR-Cas12a can facilitate the testing of various promoters:

  • Strong constitutive promoters like psbA1

  • Inducible systems like the DAPG-inducible PhlF repressor system

  • Creation of promoter libraries to identify optimal expression levels

Genetic circuit engineering:

  • Implement multiplex editing (demonstrated efficiency of 25%) to simultaneously modify multiple genomic targets

  • Create Lnt variants with modified membrane-association domains

  • Engineer markerless mutations using the CRISPR-Cas12a approach described by Mills et al.

Host optimization:

  • Modify pathways affecting membrane phospholipid composition to create a more favorable environment for Lnt activity

  • Engineering reduced protease activity to improve recombinant protein stability

  • Modify cell wall characteristics to facilitate protein extraction

These strategies can be implemented using the modular method for generating markerless mutants described in the literature , providing precise control over Lnt expression and activity.

What are the mechanistic differences between the catalytic activities of native Lnt versus recombinant Lnt from Synechococcus sp.?

Comparing the catalytic mechanisms of native versus recombinant Lnt reveals important insights about the influence of expression systems on enzyme function:

Reaction mechanism comparison:
Both native and recombinant Lnt follow a ping-pong type mechanism involving:

  • Formation of a thioester acyl-enzyme intermediate (slow step)

  • Transfer of the acyl group to the apolipoprotein substrate (fast step)

Key kinetic parameters to compare:

Structural considerations:

  • Potential differences in membrane topology between expression systems

  • Altered protein dynamics in different membrane environments

  • Impact of purification tags on enzyme conformation and substrate access

Understanding these differences is crucial for interpreting experimental results and optimizing recombinant Lnt production.

How can structural engineering approaches improve the functionality of recombinant Lnt in Synechococcus sp.?

Strategic structural engineering can significantly enhance recombinant Lnt functionality:

Targeted modifications:

  • Membrane association optimization:

    • Modify transmembrane domains to better match Synechococcus membrane thickness

    • Engineer improved phospholipid interaction sites based on headgroup availability

    • Adjust hydrophobic mismatch at membrane interfaces

  • Catalytic site engineering:

    • Preserve the essential catalytic cysteine involved in thioester formation

    • Optimize residues involved in phospholipid headgroup recognition

    • Enhance substrate binding without compromising catalysis

  • Stability enhancements:

    • Introduce disulfide bonds away from the active site to stabilize tertiary structure

    • Modify surface charges to improve solubility while maintaining membrane association

    • Engineer salt bridges to stabilize critical domains

  • Flexible linker design:

    • Optimize the connection between the His-TEV tag and the enzyme to minimize interference

    • Design linkers that facilitate proper membrane insertion

    • Ensure purification tags don't disrupt catalytically important regions

Implementation approach:

  • Utilize computational modeling to predict effective modifications

  • Create a library of variants with different modifications

  • Screen for expression level, stability, and activity

  • Combine beneficial modifications to create optimized variants

  • Verify that modifications don't disrupt the ping-pong mechanism

The dual-tagging system (N-terminal 6His-TEV and C-terminal V5-His) available in the Synechococcus expression system provides flexibility for implementing and testing these modifications .

What are the common challenges in achieving active recombinant Lnt expression in Synechococcus sp.?

Researchers frequently encounter several challenges when expressing active recombinant Lnt:

Expression-related challenges:

  • Toxicity: Overexpression of membrane proteins can disrupt host membrane integrity

    • Solution: Use inducible expression systems like the DAPG-inducible PhlF repressor

    • Solution: Lower growth temperature to slow expression rate

  • Incomplete segregation: Obtaining fully segregated transformants can be difficult

    • Solution: Extended antibiotic selection (multiple rounds of streaking)

    • Solution: PCR verification of complete segregation before proceeding

  • Incorrect localization: Improper membrane targeting or insertion

    • Solution: Verify membrane fraction localization through western blotting

    • Solution: Consider adding native signal sequences if absent

Activity-related challenges:

  • Phospholipid environment incompatibility: Lnt activity is strongly affected by phospholipid composition

    • Solution: Supplement with preferred phospholipids during activity assays

    • Solution: Consider membrane engineering approaches

  • Improper folding: Despite expression, protein may not fold correctly

    • Solution: Test multiple detergents for solubilization

    • Solution: Employ chaperone co-expression strategies

  • Catalytic residue modification: The crucial thioester-forming cysteine may be modified

    • Solution: Include reducing agents in purification buffers

    • Solution: Verify thioester formation capability using mass spectrometry

Detection challenges:

  • Low signal-to-noise ratio in activity assays

    • Solution: Optimize substrates based on published work with FSL-1

    • Solution: Increase enzyme concentration or extend reaction time

  • Distinguishing enzyme-catalyzed from non-enzymatic acyl transfer

    • Solution: Include catalytic mutant controls

    • Solution: Perform detailed kinetic analysis demonstrating enzyme dependence

How can I resolve contradictory data regarding substrate specificity of recombinant Lnt?

When facing contradictory substrate specificity data, a systematic investigative approach is necessary:

Sources of contradictory data:

  • Different assay systems (in vivo vs. in vitro, different detection methods)

  • Variations in protein preparation (expression conditions, purification methods)

  • Different phospholipid environments affecting specificity

  • Substrate variations (purity, presentation method)

Systematic investigation framework:

  • Standardize methodology:

    • Establish consistent assay conditions across experiments

    • Implement multiple detection methods (e.g., radiolabeling and mass spectrometry)

    • Include appropriate positive and negative controls

  • Control for protein quality:

    • Verify protein folding and homogeneity before experiments

    • Use fresh protein preparations to minimize degradation effects

    • Quantify active enzyme concentration through active site titration

  • Examine substrate factors:

    • Verify substrate purity through analytical methods

    • Test substrate concentration dependencies

    • Compare different substrate presentation methods (micelles vs. liposomes)

  • Data analysis matrix:

VariableCondition 1Condition 2Condition 3Interpretation
Phospholipid compositionPE-richPC-richPG-richDetermines headgroup preference
Detergent systemTriton X-100DDMDigitoninAffects enzyme conformation
Substrate concentration1-10 μM10-100 μM100-1000 μMReveals concentration dependencies
pH6.57.58.5Identifies optimal conditions
Temperature25°C30°C37°CDetermines thermal preferences
  • Model development:

    • Look for patterns explaining contradictions

    • Consider whether differences reflect distinct enzyme conformations

    • Develop a comprehensive model accommodating seemingly contradictory observations

This systematic approach can transform contradictory data into deeper mechanistic understanding of enzyme behavior.

How can I determine if recombinant Lnt from Synechococcus sp. is properly folded and catalytically competent?

Assessing proper folding and catalytic competence of recombinant Lnt requires a multi-faceted approach:

Structural integrity assessment:

  • Size exclusion chromatography to verify monodispersity and appropriate oligomeric state

  • Circular dichroism spectroscopy to confirm secondary structure content

  • Limited proteolysis to probe tertiary structure (properly folded membrane proteins show characteristic resistance patterns)

  • Thermal stability assays to determine melting temperature and stability

Membrane integration verification:

  • Membrane fractionation to confirm localization in membrane fractions

  • Protease protection assays to determine proper topology

  • Detergent extraction profiles to verify characteristic membrane protein behavior

Functional verification hierarchy:

  • Phospholipid binding: Verify interaction with phospholipids using fluorescent probes

  • Thioester intermediate formation: Detect the acyl-enzyme intermediate by mass spectrometry

  • Substrate binding: Confirm interaction with lipopeptide substrates like FSL-1

  • Complete catalytic cycle: Demonstrate full N-acyltransferase activity

Comparative benchmarking:

  • Compare spectroscopic properties with well-characterized membrane proteins

  • Benchmark activity against native Lnt when available

  • Correlate structural parameters with functional outcomes

This comprehensive assessment provides confidence in the structural integrity and catalytic functionality of the recombinant Lnt protein.

What experimental approaches can distinguish between limitations in recombinant Lnt expression versus detection sensitivity?

Distinguishing between expression limitations and detection issues requires targeted experimental approaches:

Expression level assessment:

  • Quantitative western blotting: Compare recombinant Lnt levels to known standards using anti-His or anti-V5 antibodies

  • Fluorescent fusion reporters: Create GFP fusions to directly visualize expression levels

  • mRNA quantification: Measure transcript levels using RT-qPCR

  • Pulse-chase labeling: Determine protein synthesis and turnover rates

Detection sensitivity evaluation:

  • Limit of detection determination: Establish minimum detectable enzyme concentration

  • Signal amplification methods: Implement coupled enzyme assays to enhance sensitivity

  • Alternative detection technologies: Compare radioactive, fluorescent, and mass spectrometry approaches

  • Substrate concentration optimization: Ensure substrate levels are appropriate for detection

Distinguishing experimental matrix:

ObservationExpression LimitationDetection LimitationDistinguishing Test
No activity detectedInsufficient protein expressedActivity below detection thresholdConcentrate protein and retest
Inconsistent activityVariable expression levelsVariable assay performanceNormalize activity to protein amount
Activity not proportional to proteinInactive protein fractionNon-linear detection rangeVerify detection system linearity
Substrate-dependent activity lossSubstrate inhibitionSubstrate interference with detectionVary substrate presentation method

Optimization strategies:

  • For confirmed expression limitations:

    • Optimize codon usage for Synechococcus

    • Test different promoters and RBS sequences

    • Explore alternative integration sites

  • For confirmed detection limitations:

    • Implement more sensitive detection methods

    • Optimize reaction conditions based on ping-pong mechanism

    • Increase reaction time for product accumulation

This systematic approach allows researchers to accurately identify and address the true limiting factors in their experimental system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.