Recombinant Synechococcus sp. ATP synthase protein I (atpI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, serving as a reference for your convenience.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
atpI; atp1; syc1183_c; ATP synthase protein I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-118
Protein Length
full length protein
Species
Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)
Target Names
atpI
Target Protein Sequence
MAEYYALQRQLLQVTLICTVVIFGAVWWAYSLNTAASYLLGAMGGLLYLRMLGKAVERIG ERRRQFGKSRLALFVVLIVLAARWQYLELMPVFLGFLTYKAALIWYTLRAVIPTAENS
Uniprot No.

Target Background

Function
This protein potentially plays a role in guiding the assembly of the membrane sector of the ATPase enzyme complex.
Database Links
Protein Families
Bacterial AtpI family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase protein I (atpI) in Synechococcus sp. and what is its function?

ATP synthase protein I (atpI) is an integral component of the ATP synthase complex in Synechococcus sp., a model cyanobacterium used in photosynthesis research. The ATP synthase complex is a multi-subunit, membrane-associated protein assembly that converts ADP and inorganic phosphate (Pi) into ATP using an electrochemical proton motive force across the membrane . In cyanobacteria like Synechococcus, ATP synthase is particularly critical for energy conversion during photosynthesis, facilitating the organism's ability to convert light energy into chemical energy. The atpI subunit specifically contributes to the membrane-embedded Fo portion of the complex, which is involved in proton translocation across the membrane.

What expression systems are recommended for recombinant Synechococcus sp. atpI production?

For optimal recombinant expression of Synechococcus sp. atpI, E. coli-based expression systems have proven successful . Specifically, E. coli strains optimized for membrane protein expression, such as Rosetta (DE3) and BL21 (DE3)-RIL, can provide high yields with proper induction conditions . Based on experience with other cyanobacterial proteins, two induction protocols have demonstrated effectiveness:

  • Short induction: 3 hours at 37°C following IPTG addition

  • Extended induction: Overnight (16-18 hours) at 16°C following IPTG addition

The inclusion of an N-terminal His tag facilitates subsequent purification via immobilized metal affinity chromatography . For membrane proteins like atpI, expression constructs may benefit from the addition of fusion partners that enhance solubility or membrane integration, though care must be taken that these additions don't interfere with protein function if functional studies are planned.

What are the optimal storage and reconstitution conditions for recombinant atpI?

Optimal handling of recombinant Synechococcus sp. atpI requires specific storage and reconstitution protocols to maintain protein integrity:

ParameterRecommended ConditionNotes
Long-term storage-20°C/-80°CAliquoting necessary to avoid freeze-thaw cycles
Short-term storage4°CViable for up to one week
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0Stabilizes protein structure
Reconstitution mediumDeionized sterile waterTo a concentration of 0.1-1.0 mg/mL
Glycerol addition5-50% final concentration (50% default)For cryoprotection during freezing
Handling precautionBrief centrifugation before openingBrings contents to bottom of vial

Repeated freeze-thaw cycles should be strictly avoided as they significantly reduce protein stability and functionality . For membrane protein studies requiring functional reconstitution, additional steps involving detergent solubilization and incorporation into liposomes or nanodiscs may be necessary following initial reconstitution.

How does bacterial atpI differ from ATP synthase components in other organisms?

While ATP synthases maintain a conserved core structure across different domains of life, cyanobacterial atpI exhibits several distinctive features that reflect its evolutionary adaptation to photosynthetic energy metabolism:

  • Sequence adaptations: Cyanobacterial atpI contains specific sequence motifs that facilitate its integration into thylakoid membranes, which differ in composition from mitochondrial or chloroplast membranes .

  • Functional versatility: Unlike mitochondrial ATP synthases, which primarily function in respiration, cyanobacterial ATP synthases must operate effectively in both respiratory and photosynthetic electron transport chains, requiring greater functional flexibility .

  • Regulatory elements: Cyanobacterial atpI likely contains regulatory elements that respond to light-dark transitions, allowing rapid adaptation to changing energy availability during diurnal cycles.

  • Evolutionary significance: As ancestors to chloroplasts, cyanobacterial ATP synthase components represent evolutionary intermediates between bacterial and plant ATP synthases, with atpI exhibiting characteristics that reflect this transitional position.

These differences highlight why cyanobacterial atpI serves as an important research subject for understanding the evolution and adaptation of ATP synthases in photosynthetic organisms.

What are the challenges in characterizing the function of recombinant Synechococcus sp. atpI in vitro?

Characterizing recombinant Synechococcus sp. atpI presents several methodological challenges that researchers must address:

  • Membrane environment reconstitution: As a membrane protein, atpI requires a lipid environment that mimics its native membrane context to maintain proper folding and function. Researchers must carefully select lipid compositions that reflect the unique properties of cyanobacterial thylakoid membranes .

  • Complex formation requirements: ATP synthase functions as a multi-subunit complex, with atpI's role dependent on interactions with other subunits. Studying isolated atpI may not reflect its native functional properties, necessitating co-expression or reconstitution with partner proteins .

  • Orientation control: For functional studies, controlling the orientation of atpI within membrane mimetics is essential, as incorrect orientation can prevent proper proton translocation and interactions with other ATP synthase components.

  • Stability concerns: The protein exhibits temperature and pH sensitivity, requiring careful buffer optimization and handling protocols to prevent denaturation during purification and analysis .

  • Functional assay limitations: Assessing the specific contribution of atpI to ATP synthase function requires specialized assays that can isolate its role from that of other subunits, presenting technical challenges in experimental design.

Researchers can address these challenges through techniques like nanodisc reconstitution, co-expression systems, and the development of specialized functional assays tailored to investigating membrane protein complexes.

How can researchers investigate the interaction between atpI and other ATP synthase subunits?

Investigating protein-protein interactions involving membrane proteins like atpI requires specialized approaches:

  • Crosslinking techniques: Chemical crosslinking combined with mass spectrometry can identify interaction interfaces between atpI and other ATP synthase subunits. This approach involves:

    • Treating intact ATP synthase complexes with bifunctional crosslinkers

    • Digesting the crosslinked complexes with proteases

    • Analyzing the resulting peptides by mass spectrometry to identify crosslinked residues

    • Mapping these residues onto structural models to define interaction interfaces

  • Co-purification strategies: Co-expression of atpI with other tagged ATP synthase subunits, followed by tandem affinity purification, can isolate native-like subcomplexes for structural and functional characterization .

  • Microscale thermophoresis: This technique can quantify binding affinities between purified atpI and partner proteins under near-native conditions, providing insights into the energetics of complex assembly.

  • Structure determination: Cryo-electron microscopy of reconstituted ATP synthase complexes can reveal the structural arrangement of atpI relative to other subunits at near-atomic resolution, particularly effective for membrane protein complexes .

  • FRET-based approaches: Fluorescently labeled atpI and partner proteins can be used to monitor real-time assembly and conformational changes within the ATP synthase complex using Förster Resonance Energy Transfer.

These complementary approaches can provide a comprehensive understanding of atpI's structural and functional relationships within the ATP synthase complex.

What techniques are most effective for studying the membrane integration of recombinant atpI?

Several specialized techniques effectively characterize the membrane integration properties of recombinant atpI:

  • Proteoliposome reconstitution: Purified atpI can be incorporated into liposomes of defined lipid composition, allowing assessment of:

    • Insertion efficiency under different lipid conditions

    • Orientation within the membrane

    • Functional properties in a membrane environment

  • Hydrogen/deuterium exchange mass spectrometry: This approach identifies membrane-protected regions of atpI by measuring the rate of hydrogen/deuterium exchange along the protein backbone, revealing which segments are embedded within the lipid bilayer.

  • Site-directed spin labeling combined with electron paramagnetic resonance (EPR): By introducing spin labels at specific positions throughout atpI, researchers can map the depth and orientation of different protein regions within the membrane.

  • Fluorescence quenching: Introducing fluorescent probes at strategic positions within atpI allows measurement of their accessibility to membrane-impermeable quenchers, providing information about membrane topology.

  • Molecular dynamics simulations: Computational approaches can model atpI's interactions with lipid bilayers, predicting stable configurations and identifying key lipid-protein interactions that govern membrane integration .

These techniques provide complementary information about atpI's membrane integration, from broad topological features to specific molecular interactions that stabilize its membrane-embedded state.

How can researchers assess the impact of mutations in the atpI gene on ATP synthase function?

A systematic approach to evaluating the functional consequences of atpI mutations includes:

  • Site-directed mutagenesis strategy:

    • Conservative substitutions to test specific chemical properties

    • Alanine-scanning mutagenesis to identify essential residues

    • Introduction of disease-relevant mutations identified in orthologous proteins

    • Creation of chimeric proteins swapping regions between different species

  • Expression and functional characterization:

    • Reconstitution of mutant proteins into liposomes or nanodiscs

    • Measurement of proton translocation efficiency

    • Assessment of ATP synthesis/hydrolysis rates

    • Evaluation of complex assembly and stability

  • In vivo assessment in model organisms:

    • Generation of Synechococcus strains expressing mutant atpI

    • Growth phenotyping under different light and energy conditions

    • Measurement of cellular ATP/ADP ratios and membrane potential

    • Analysis of ATP synthase complex formation using BN-PAGE

  • Structural analysis:

    • Cryo-EM structures of ATP synthase complexes containing mutant atpI

    • Computational modeling of mutation effects on protein stability and interactions

    • Hydrogen/deuterium exchange to detect conformational changes

This multifaceted approach enables researchers to connect specific amino acid positions in atpI with their functional roles in ATP synthase activity, providing mechanistic insights into how mutations affect energy conservation in cyanobacteria .

What methodologies are available for investigating atpI's role in energy metabolism in Synechococcus sp.?

Investigating atpI's contribution to cyanobacterial energy metabolism requires integrating molecular, biochemical, and physiological approaches:

  • Genetic manipulation strategies:

    • CRISPR/Cas9-based gene editing to create atpI knockouts or targeted mutations

    • Inducible expression systems to modulate atpI levels

    • Complementation with heterologous atpI genes to assess functional conservation

  • Bioenergetic parameter measurements:

    • Oxygen evolution and consumption rates using Clark-type electrodes

    • Membrane potential determination using voltage-sensitive fluorescent dyes

    • ATP/ADP ratio quantification using luciferase-based assays

    • NAD(P)H fluorescence to monitor electron transport chain activity

  • Photosynthetic efficiency analysis:

    • Pulse-amplitude modulation (PAM) fluorometry to measure quantum yield

    • P700 absorbance changes to assess photosystem I activity

    • Chlorophyll fluorescence induction kinetics (OJIP test) for electron transport chain integrity

  • Systems biology approaches:

    • Metabolic flux analysis using isotope labeling to track carbon and energy flow

    • Transcriptomics to identify compensatory responses to atpI perturbation

    • Proteomics to detect changes in ATP synthase complex composition and abundance

  • Environmental response studies:

    • Analysis of atpI contribution under varying light intensities

    • Assessment of role during nutrient limitation stress

    • Evaluation of importance during temperature stress adaptation

These methodologies collectively enable researchers to define the precise contribution of atpI to maintaining energy homeostasis under diverse environmental conditions in Synechococcus.

How does atpI expression change under different environmental conditions in Synechococcus sp.?

ATP synthase regulation represents a critical adaptation mechanism in cyanobacteria responding to environmental fluctuations. Research methodologies to investigate atpI expression dynamics include:

  • Transcriptional regulation analysis:

    • RNA-seq to profile global transcriptional responses under varying conditions

    • qRT-PCR for targeted quantification of atpI transcript levels

    • Promoter-reporter fusions to visualize expression patterns in real-time

    • ChIP-seq to identify transcription factors regulating atpI expression

  • Environmental condition variations:

    • Light intensity gradients (from limiting to excess light)

    • Spectral quality changes (blue vs. red light predominance)

    • Carbon availability (CO2-limited vs. CO2-enriched)

    • Nutrient status (nitrogen, phosphorus, iron limitation)

    • Temperature shifts (cold stress, heat stress)

  • Protein level quantification:

    • Western blotting with atpI-specific antibodies

    • Targeted proteomics using multiple reaction monitoring

    • Pulse-chase experiments to determine protein turnover rates

    • Correlation of protein abundance with ATP synthase activity

  • Co-expression network analysis:

    • Identification of genes co-regulated with atpI

    • Inference of regulatory mechanisms and environmental response pathways

    • Comparative analysis across multiple cyanobacterial species

Research indicates that cyanobacteria exhibit sophisticated regulation of ATP synthase components in response to changing light environments, with significant implications for understanding photosynthetic energy conversion efficiency and evolutionary adaptations .

What are the implications of studying cyanobacterial atpI for understanding evolutionary adaptations in ATP synthases?

Cyanobacterial ATP synthases occupy a unique evolutionary position with significant implications for understanding the diversification of these essential energy-converting complexes:

  • Endosymbiotic theory connections:

    • Cyanobacterial ATP synthases represent ancestors to chloroplast ATP synthases

    • Comparative analysis of atpI from cyanobacteria and chloroplasts reveals selection pressures during endosymbiosis

    • Identification of conserved features essential for function across evolutionary time

  • Adaptation to photosynthetic lifestyle:

    • Cyanobacterial atpI contains adaptations for functioning in the thylakoid membrane environment

    • Coordination with photosynthetic electron transport components reflects evolutionary optimization

    • Regulatory mechanisms responding to light-dark transitions represent specialized adaptations

  • Structural and functional innovations:

    • Unique sequence elements in cyanobacterial atpI may reveal novel mechanisms for proton translocation

    • Specialized interactions with other ATP synthase subunits could represent evolutionary innovations

    • Comparative structural analysis can identify conserved functional domains versus lineage-specific adaptations

  • Methodology for evolutionary studies:

    • Ancestral sequence reconstruction to infer properties of proto-cyanobacterial atpI

    • Functional complementation across species to test evolutionary conservation

    • Phylogenetic analysis correlating sequence changes with environmental adaptations

Studying Synechococcus atpI provides a window into the evolutionary processes that shaped energy conservation mechanisms during the transition from prokaryotic to eukaryotic photosynthesis, with implications for understanding fundamental aspects of cellular energetics .

What purification strategies yield the highest purity and activity for recombinant Synechococcus sp. atpI?

Optimized purification protocols for recombinant atpI must address the challenges inherent to membrane protein isolation:

  • Extraction optimization:

    • Detergent screening (mild detergents like DDM, LMNG, or digitonin typically preserve activity)

    • Detergent-to-protein ratio optimization to prevent aggregation

    • Inclusion of stabilizing agents (glycerol, specific lipids) throughout purification

  • Chromatography strategy:

    • Initial capture: IMAC (Immobilized Metal Affinity Chromatography) using His-tag

    • Intermediate purification: Ion exchange chromatography at optimized pH

    • Polishing step: Size exclusion chromatography to remove aggregates and isolate properly folded protein

  • Quality assessment methods:

    • SDS-PAGE with Coomassie staining to verify >90% purity

    • Western blotting with anti-His antibodies to confirm identity

    • Mass spectrometry to verify protein integrity and detect modifications

    • Circular dichroism to assess secondary structure integrity

  • Activity preservation considerations:

    • Maintenance of cold temperatures throughout purification

    • Addition of ATP or non-hydrolyzable analogs to stabilize conformation

    • Immediate reconstitution into liposomes or nanodiscs for functional studies

Researchers using this optimized protocol can expect yields of 2-5 mg of pure, active protein per liter of E. coli culture, sufficient for comprehensive biochemical and structural characterization .

How can researchers effectively reconstitute recombinant atpI into functional membrane systems?

Functional reconstitution of atpI into membrane mimetic systems requires careful consideration of lipid composition, protein-to-lipid ratios, and orientation control:

  • Liposome reconstitution protocol:

    • Selection of lipids mimicking cyanobacterial membranes (MGDG, DGDG, SQDG, PG)

    • Preparation of unilamellar vesicles by extrusion through defined pore sizes

    • Controlled detergent removal using dialysis or bio-beads

    • Verification of incorporation by flotation assays or freeze-fracture electron microscopy

  • Nanodisc assembly strategy:

    • Selection of appropriate membrane scaffold protein (MSP) variants

    • Optimization of atpI:MSP:lipid ratios

    • Stepwise detergent removal for controlled assembly

    • Size verification by size exclusion chromatography

  • Functional assessment methods:

    • Proton translocation assays using pH-sensitive fluorescent dyes

    • ATPase activity measurements under various conditions

    • Conformational dynamics assessment using single-molecule techniques

    • Integration into ATP synthesis assays with purified F1 components

  • Co-reconstitution considerations:

    • Sequential or simultaneous incorporation of multiple ATP synthase subunits

    • Verification of proper subcomplex assembly

    • Assessment of cooperative functions requiring multiple subunits

These reconstitution methods provide researchers with tools to investigate atpI's function in isolation or as part of larger ATP synthase subcomplexes, enabling detailed mechanistic studies of its role in proton translocation and complex assembly .

What are the best approaches for studying the interaction of atpI with the proton gradient in Synechococcus sp.?

Investigating how atpI interacts with the proton gradient requires specialized techniques that can detect proton movement and correlate it with protein structure and function:

  • Proton flux measurement techniques:

    • pH-sensitive fluorescent dyes (ACMA, pyranine) to monitor proton movement

    • Site-specific pH-sensitive probes incorporated at strategic positions in atpI

    • Patch-clamp electrophysiology of liposomes containing reconstituted atpI

    • Solid-supported membrane electrophysiology for direct current measurements

  • Structure-function correlation methods:

    • Identification of conserved charged residues in atpI sequence

    • Site-directed mutagenesis of potential proton-conducting residues

    • Correlation of mutations with proton translocation efficiency

    • Molecular dynamics simulations of proton movement through atpI

  • In vivo approaches:

    • Implementation of pH-sensitive fluorescent proteins in Synechococcus

    • Correlation of intracellular pH changes with ATP synthase activity

    • Measurement of proton motive force under various environmental conditions

    • Assessment of pH gradient impact on growth and energy metabolism

  • Advanced biophysical methods:

    • Time-resolved FTIR spectroscopy to detect protonation/deprotonation events

    • Neutron scattering to locate protons within the protein structure

    • Electrometric measurements of charge translocation

These methodologies collectively enable researchers to build a comprehensive model of how atpI contributes to proton translocation in the ATP synthase complex, a fundamental aspect of bioenergetic coupling in cyanobacteria .

What are the considerations when designing mutations to study structure-function relationships in atpI?

Designing a comprehensive mutational analysis strategy for atpI requires careful consideration of sequence conservation, structural features, and experimental readouts:

  • Target selection rationale:

    • Highly conserved residues across cyanobacterial species

    • Charged residues potentially involved in proton translocation

    • Residues at predicted subunit interfaces

    • Regions with predicted membrane interfaces

    • Sites associated with known ATP synthase inhibitor binding

  • Mutation design principles:

    • Conservative substitutions (maintaining charge but altering size)

    • Charge reversal mutations to test electrostatic interactions

    • Cysteine substitutions for subsequent labeling experiments

    • Truncations to test domain importance

    • Introduction of fluorescent amino acid analogs at specific positions

  • Functional impact assessment:

    • Growth phenotypes under various energy conditions

    • ATP synthesis/hydrolysis rates

    • Proton translocation efficiency

    • Complex assembly analysis

    • Structural integrity verification

  • Data interpretation framework:

    • Correlation with structural models or experimental structures

    • Comparison with equivalent mutations in ATP synthases from other organisms

    • Integration with computational predictions of residue importance

    • Development of mechanistic models explaining observed phenotypes

A systematic mutational analysis following these principles can reveal the specific roles of key residues in atpI, contributing to a mechanistic understanding of its function in the ATP synthase complex .

How can researchers integrate structural and functional studies of atpI to understand its mechanism?

An integrated structural-functional approach provides the most comprehensive understanding of atpI's role in ATP synthase:

  • Structural characterization methods:

    • X-ray crystallography of isolated atpI (challenging but potentially high-resolution)

    • Cryo-electron microscopy of ATP synthase complexes containing atpI

    • NMR spectroscopy for dynamic regions and ligand interactions

    • SAXS/SANS for solution structure and conformational ensembles

  • Functional assessment techniques:

    • Site-directed spin labeling with EPR for conformational changes

    • FRET-based distance measurements between strategic positions

    • Single-molecule force measurements for mechanical properties

    • Electrophysiological recordings for proton translocation

  • Integration strategies:

    • Structure-guided mutagenesis followed by functional assessment

    • Computational modeling validated by experimental distances

    • Correlation of structural states with functional outputs

    • Time-resolved structural methods synchronized with functional measurements

  • Multi-scale approach:

    • Atomic resolution structures for detailed interaction networks

    • Mesoscale dynamics for conformational changes during function

    • Whole-complex integration for understanding cooperative mechanisms

    • Cellular context for physiological relevance

This integrated approach enables researchers to connect structural features of atpI to specific functional roles, building a mechanistic model of how this protein contributes to ATP synthase function in Synechococcus sp. .

What experimental systems allow for monitoring atpI function in real-time?

Real-time monitoring of atpI function requires development of specialized experimental systems that can detect dynamic changes in protein structure, activity, or environmental interactions:

  • Fluorescence-based approaches:

    • Site-specific incorporation of environmentally sensitive fluorophores

    • FRET pairs at dynamic interfaces to detect conformational changes

    • pH-sensitive fluorescent probes to monitor proton movement

    • Fluorescence correlation spectroscopy for diffusion and interaction dynamics

  • Electrical measurement systems:

    • Tethered bilayer lipid membranes with integrated electrodes

    • Patch-clamp apparatus for reconstituted proteoliposomes

    • Solid-supported membrane electrophysiology platforms

    • Microelectrode arrays for spatial resolution of proton movements

  • Microscopy techniques:

    • Total internal reflection fluorescence microscopy for membrane dynamics

    • High-speed atomic force microscopy for conformational changes

    • Super-resolution microscopy for nanoscale distribution and dynamics

    • Single-particle tracking for membrane diffusion behavior

  • Spectroscopic methods:

    • Time-resolved FTIR for protonation state changes

    • EPR for spin label mobility during function

    • Surface-enhanced Raman spectroscopy for local chemical environment

    • NMR for residue-specific dynamics during function

These real-time monitoring systems allow researchers to correlate structural dynamics with functional outputs, providing insights into the transient states and conformational changes that underlie atpI's role in ATP synthase function .

How can computational approaches complement experimental studies of Synechococcus sp. atpI?

Computational methods provide valuable insights that complement experimental investigations of atpI:

  • Sequence-based predictions:

    • Transmembrane topology prediction using algorithms like TMHMM or Phobius

    • Evolutionary analysis to identify conserved functional motifs

    • Coevolution analysis to predict residue contacts between atpI and other subunits

    • Disorder prediction to identify flexible regions important for function

  • Structural modeling approaches:

    • Homology modeling based on structures of related proteins

    • Ab initio modeling for unique regions without structural templates

    • Molecular dynamics simulations to predict dynamic behavior

    • Molecular docking to predict interactions with other ATP synthase components

  • Integrative computational methods:

    • Combined experimental/computational workflows (e.g., Rosetta with experimental constraints)

    • Molecular dynamics flexible fitting to interpret low-resolution structural data

    • Network analysis of protein-protein interactions within the ATP synthase complex

    • Systems biology models integrating atpI function with cellular energetics

  • Advanced simulation approaches:

    • Quantum mechanics/molecular mechanics simulations for proton transfer events

    • Coarse-grained simulations for longer timescale dynamics

    • Free energy calculations for membrane integration energetics

    • Machine learning approaches to predict functional sites

These computational methods generate testable hypotheses, guide experimental design, and provide mechanistic interpretations of experimental data that might not be directly observable through experimental means alone .

What are the challenges and solutions in expressing and studying mutant variants of atpI?

Working with mutant variants of membrane proteins like atpI presents specific challenges that require specialized approaches:

  • Expression challenges and solutions:

    • Potential toxicity: Use tightly controlled induction systems or toxic-tolerant E. coli strains

    • Reduced stability: Co-express with chaperones or at lower temperatures

    • Membrane integration issues: Test multiple expression systems (bacterial, yeast, insect)

    • Aggregation tendency: Screen multiple detergents and stabilizing additives

  • Purification considerations:

    • Variable extraction efficiency: Optimize detergent-to-protein ratios for each mutant

    • Differential stability: Develop mutant-specific buffer conditions

    • Altered tag accessibility: Consider dual tagging strategies

    • Modified oligomeric states: Use appropriate size exclusion conditions

  • Functional characterization adaptations:

    • Activity spectrum: Develop assays sensitive to partial activities

    • Reconstitution variability: Standardize protocols using internal controls

    • Different kinetic parameters: Expand concentration ranges in assays

    • Alternative mechanisms: Implement multiple complementary activity assays

  • Structural assessment approaches:

    • Stability differences: Perform thermal shift assays to find optimal conditions

    • Conformational heterogeneity: Use negative stain EM for quality assessment

    • Local structural changes: Implement hydrogen/deuterium exchange MS

    • Dynamic alterations: Apply NMR for site-specific mobility assessment

By anticipating these challenges and implementing appropriate solutions, researchers can successfully express, purify, and characterize even significantly altered variants of atpI, enabling comprehensive structure-function analyses .

What emerging technologies might advance our understanding of atpI function in ATP synthase?

Several cutting-edge technologies promise to deepen our understanding of atpI's role in ATP synthase:

  • Structural biology advances:

    • Time-resolved cryo-EM to capture conformational states during function

    • Micro-electron diffraction (MicroED) for membrane protein crystallography

    • Integrative structural biology combining multiple data types

    • In-cell structural determination methods

  • Single-molecule approaches:

    • High-speed AFM for direct visualization of conformational dynamics

    • Magnetic tweezers for measuring forces during ATP synthase operation

    • Zero-mode waveguides for single-molecule fluorescence of membrane proteins

    • Correlative light and electron microscopy for structure-function studies

  • Genetic and cellular technologies:

    • Genome-wide CRISPR screens to identify genetic interactions with atpI

    • Optogenetic control of ATP synthase components

    • Expanded genetic code for site-specific incorporation of novel probes

    • Synthetic cellular systems with minimal ATP synthases

  • Advanced computational methods:

    • AI-driven protein structure prediction specifically optimized for membrane proteins

    • Exascale computing for longer-timescale molecular dynamics

    • Quantum computing approaches for electronic structure calculations

    • Multi-scale modeling connecting molecular events to cellular physiology

These emerging technologies will enable unprecedented insights into the dynamic operation of atpI within the ATP synthase complex, potentially revealing new functional mechanisms and regulatory principles .

How might research on Synechococcus sp. atpI contribute to synthetic biology applications?

Understanding atpI's structure and function opens possibilities for innovative synthetic biology applications:

  • Engineered energy systems:

    • Development of synthetic ATP synthases with enhanced efficiency

    • Creation of artificial photosynthetic systems incorporating optimized atpI variants

    • Design of minimal ATP synthase complexes for nanoscale power generation

    • Engineering of ATP synthases that function with alternative ion gradients

  • Biotechnology applications:

    • Development of biosensors based on atpI conformational changes

    • Creation of ATP-regenerating systems for cell-free biotechnology

    • Engineering of cells with enhanced bioenergetic efficiency

    • Design of membrane protein expression systems optimized for ATP synthase components

  • Biomedicine opportunities:

    • Design of targeted inhibitors for pathogen-specific ATP synthases

    • Development of ATP synthase variants for cellular energy modulation

    • Creation of synthetic organelles with controlled ATP production

    • Engineering of cellular energy systems for therapeutic applications

  • Materials science integration:

    • Development of bio-hybrid materials incorporating functional ATP synthases

    • Creation of bioelectronic interfaces using ATP synthase components

    • Design of self-assembling systems based on ATP synthase architecture

    • Engineering of energy-harvesting materials inspired by ATP synthase function

These applications represent the translation of fundamental research on atpI into technologies that address challenges in renewable energy, biotechnology, medicine, and materials science .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.