Recombinant Synechococcus sp. ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
atpF; CYB_2675; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Synechococcus sp. (strain JA-2-3B'a(2-13)) (Cyanobacteria bacterium Yellowstone B-Prime)
Target Names
atpF
Target Protein Sequence
MPVWSWVAGWILAVAETTELLPEAKAGEGDLLAKILESNLINIAIILTLLFILGRKVVGE ALAKRREGILEELRQAEQRKREAIERLAEEQQKLAQAQQEAERIRKQAEANAEARRQELL EQAEREVERLRANAEKELSSEQERVFQELRRQIVRQALSKVEQELPQHLNEEVHRSLIEK GIQMIAR
Uniprot No.

Target Background

Function
F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 catalytic core (extramembraneous) and the F0 membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This subunit is a component of the F0 channel and forms part of the peripheral stalk, connecting F1 to F0.
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is the structural organization of ATP synthase in Synechococcus sp. and how does subunit b (atpF) fit into this complex?

ATP synthase in Synechococcus species comprises nine subunits organized at three separate genetic loci. The gene encoding subunit b (atpF) is part of a larger cluster with order a:c:b':b:delta:alpha. Subunit b is a critical component of the F0 portion of ATP synthase that forms the membrane-embedded proton channel. Unlike most bacteria which have two identical copies of the b subunit, cyanobacteria such as Synechococcus have both a standard b subunit (atpF) and a diverged form called b' (atpG), which appears to have evolved through gene duplication .

The b subunit in Synechococcus contains 173 amino acids and has an extra amino-terminal extension compared to its E. coli counterpart. This extension is similar to that found in chloroplast ATP synthase subunits, further supporting the evolutionary relationship between cyanobacteria and chloroplasts .

What are the optimal conditions for expression and purification of recombinant Synechococcus sp. ATP synthase subunit b (atpF)?

Based on research with similar cyanobacterial proteins, optimal expression of recombinant atpF can be achieved in E. coli expression systems under the following conditions:

ParameterOptimal ConditionNotes
E. coli strainBL21(DE3) or Rosetta(DE3)Rosetta strain may be preferred due to potential rare codon usage in cyanobacterial genes
Induction temperature16°C overnight or 37°C for 3 hoursLower temperature typically yields more soluble protein
IPTG concentration0.5-1.0 mMHigher concentrations don't necessarily improve yield
MediaLB or TBTB media generally yields higher biomass
Purification methodNi-NTA chromatography for His-tagged proteinFollowed by size-exclusion chromatography

What methods can be used to verify the proper folding and functionality of recombinant atpF protein?

Several complementary approaches can be used to verify the proper folding and functionality of recombinant atpF:

  • Circular Dichroism (CD) Spectroscopy: To assess secondary structure content (alpha-helices and beta-sheets)

  • Limited Proteolysis: Properly folded proteins often show resistance to proteolytic digestion compared to misfolded forms

  • ATP Synthase Reconstitution Assays:

    • Reconstitution with other ATP synthase subunits to form functional complexes

    • Measuring ATP hydrolysis/synthesis activity of the reconstituted complex

  • Binding Studies:

    • Interaction with known partner subunits using co-immunoprecipitation

    • Surface plasmon resonance (SPR) to measure binding kinetics with other subunits

  • Thermal Shift Assays: To determine protein stability and proper folding

When assessing functionality, it's important to note that the isolated b subunit doesn't have enzymatic activity on its own but contributes to the structural stability of the ATP synthase complex and is essential for proton translocation through the F0 portion.

How can recombinant atpF be used to study the evolutionary relationship between cyanobacterial and chloroplast ATP synthases?

The recombinant atpF protein provides a valuable tool for comparative evolutionary studies between cyanobacterial and chloroplast ATP synthases due to their close phylogenetic relationship. Research approaches include:

  • Structural Comparison Studies: The amino-terminal extension present in Synechococcus atpF is similar to that found in chloroplast homologs but absent in most bacterial b subunits. This extension is known to undergo post-translational processing in chloroplasts . Recombinant atpF can be used to:

    • Determine the structure of this extension using X-ray crystallography or NMR

    • Study its role in assembly and function through truncation experiments

  • Hybrid Complex Formation: Experiments can be designed to test whether:

    • Recombinant Synechococcus atpF can substitute for the equivalent subunit in chloroplast ATP synthase

    • The interchangeability of subunits reflects their evolutionary relationship

  • Bioinformatic Analysis: The amino acid sequence of recombinant atpF can be used for:

    • Building refined phylogenetic trees

    • Identifying conserved domains and sequence motifs across cyanobacteria and chloroplasts

  • Protein Interaction Studies: Comparing interaction patterns between atpF and other ATP synthase subunits across different organisms

Sequence alignments have revealed high conservation of ATP synthase subunits between cyanobacteria and chloroplasts, with particularly strong conservation in the alpha, beta, and c subunits , supporting endosymbiotic theory.

What role does the atpF subunit play in energy conversion efficiency and stress tolerance in Synechococcus?

Research using recombinant ATP synthase components and genetic studies has revealed important insights into how atpF contributes to energy conversion and stress tolerance:

  • Stress Response Mechanism:
    Although most stress-related studies have focused on the alpha subunit (AtpA) rather than atpF specifically, the ATP synthase complex as a whole plays a crucial role in stress tolerance. A point mutation (C252Y) in AtpA increases ATP synthase activity, intracellular ATP concentrations, and photosystem II activity under heat stress conditions . The b subunit (atpF) likely contributes to these processes by:

    • Maintaining structural integrity of the ATP synthase complex under stress

    • Facilitating proton translocation efficiency under fluctuating conditions

  • Energy Coupling Efficiency:

    • The b subunit forms part of the peripheral stalk that connects F1 and F0 domains

    • This connection is critical for energy coupling between proton transport and ATP synthesis

    • Mutations or structural alterations in atpF could potentially affect this coupling efficiency

  • Integration with Photosynthetic Processes:
    ATP synthase activity directly affects photosynthetic efficiency through:

    • ATP supply for the Calvin cycle

    • Maintenance of appropriate thylakoid lumen pH

    • Energetic balance between photosystems

What are the common difficulties encountered when working with recombinant Synechococcus sp. ATP synthase subunit b, and how can they be addressed?

ChallengeCauseSolution
Low expression yieldMembrane protein toxicity to E. coliUse C41/C43 strains specialized for membrane protein expression; use tightly controlled expression systems
Protein insolubilityHydrophobic transmembrane domainsExpress as fusion with solubility tags (MBP, SUMO); use mild detergents for extraction
Aggregation during purificationImproper folding or detergent removalOptimize detergent type and concentration; use glycerol in buffers; purify at 4°C
Loss of structural integrityDenaturation during purificationInclude lipids or lipid-like molecules during purification; avoid harsh elution conditions
Difficulty in reconstitutionIncomplete assembly with other subunitsCo-express with partner subunits; use nanodiscs or liposomes for membrane environment

For optimal results when working with recombinant atpF, researchers should consider using specialized expression systems designed for membrane proteins and carefully optimize detergent conditions throughout purification .

How might recombinant atpF be utilized in synthetic biology applications aimed at enhancing cyanobacterial biofuel production?

Recombinant ATP synthase subunit b (atpF) offers several promising applications in synthetic biology for improving biofuel production in cyanobacteria:

  • Optimizing ATP Production Efficiency:

    • Engineering modified atpF variants with improved proton translocation efficiency

    • Creating chimeric proteins incorporating features from thermophilic organisms for robust performance under industrial conditions

    • Fine-tuning ATP synthase activity to balance energy needs for growth versus product formation

  • Stress Tolerance Engineering:

    • Developing strains with enhanced resistance to high light, temperature, and pH fluctuations

    • Adapting insights from the point mutations in atpA that improve stress tolerance (C252Y) to identify beneficial modifications in atpF

    • Creating strains that maintain photosynthetic efficiency under suboptimal conditions

  • Metabolic Redirecting:

    • Modulating ATP:NADPH ratios to favor specific metabolic pathways relevant to biofuel production

    • Engineering ATP synthase to alter intracellular ATP levels, potentially redirecting carbon flux toward desired products

  • Biosensor Development:

    • Creating biosensors based on ATP synthase components to monitor cellular energetic status

    • Using these sensors for real-time optimization of biofuel production conditions

Research has shown that ATP synthase modifications can significantly impact photosynthetic efficiency and growth rates in Synechococcus. For example, engineering the SNPs identified from fast-growing Synechococcus 2973 into the slower-growing Synechococcus 7942 increased growth rates significantly , suggesting that targeted engineering of ATP synthase components like atpF could similarly enhance bioproduction capacity.

What are the latest advances in understanding the protein-protein interactions between atpF and other ATP synthase subunits?

Recent research has advanced our understanding of the protein-protein interactions involving atpF in ATP synthase:

  • Structural Studies:

    • High-resolution cryo-EM structures have begun to reveal the detailed architecture of cyanobacterial ATP synthases

    • The b subunit (atpF) forms extended structures that span from the membrane to the catalytic F1 domain

    • These structures serve as a "stator" that prevents rotation of certain subunits while allowing others to rotate during catalysis

  • Interaction Mapping:

    • Cross-linking studies have identified specific residues in atpF that interact with other subunits

    • The N-terminal portion interacts with membrane subunits in F0, while the C-terminal region interacts with delta and alpha subunits in F1

    • The unique b/b' heterodimer in cyanobacteria (versus b/b homodimer in E. coli) creates asymmetric interactions with other subunits

  • Functional Differentiation:

    • Research suggests that b and b' subunits may have different roles despite their structural similarity

    • The divergence between b and b' sequences (~45% similarity at amino acid level) indicates functional specialization

    • This specialization may contribute to the fine regulation of ATP synthase activity in response to environmental cues

  • Assembly Pathway Studies:

    • Sequential assembly of ATP synthase components has been investigated

    • The b subunit appears to join the complex at a specific stage, coordinating F0 and F1 assembly

    • Mutations in atpF can disrupt assembly, highlighting its importance in maintaining the structural integrity of the complex

Understanding these interactions provides potential targets for engineering more efficient ATP synthase complexes and offers insights into the evolutionary adaptations that allow cyanobacteria to thrive in diverse environments.

How does the structure and function of Synechococcus sp. ATP synthase subunit b compare with homologs from other cyanobacteria and chloroplasts?

Comparative analysis of ATP synthase subunit b across species reveals important evolutionary patterns:

Organism TypeStructural FeaturesFunctional ImplicationsEvolutionary Insight
Synechococcus sp.Contains N-terminal extension; Forms heterodimer with b'Contributes to peripheral stalk; Connects F0 and F1 domainsRepresents intermediate evolutionary form
Other cyanobacteriaSimilar organization with both b and b' subunits; Sequence conservation in functional domainsSimilar roles in energy couplingConserved structural features suggest fundamental functional importance
ChloroplastsContains homologous subunit I and II; Retains N-terminal extensionPost-translational processing of N-terminal extensionSupports endosymbiotic theory of chloroplast origin
E. coli and most bacteriaLacks N-terminal extension; Forms b/b homodimerSimpler structural organizationRepresents divergent evolutionary path

The gene orders in Synechococcus ATP synthase are particularly closely related to the arrangements found in the plastid genomes of red algae and diatoms, providing strong evidence for the evolutionary relationship between cyanobacteria and chloroplasts . The presence of the extra N-terminal extension in both cyanobacterial and chloroplast ATP synthase b subunits, which undergoes post-translational processing in chloroplasts, represents a shared derived characteristic that further supports this evolutionary connection .

What insights can be gained from studying sequence variations in atpF across different Synechococcus strains?

Analysis of atpF sequence variations across Synechococcus strains provides valuable insights into adaptation and evolution:

  • Environmental Adaptation Markers:

    • Sequence variations often correlate with environmental niche (freshwater vs. marine strains)

    • Fast-growing strains like Synechococcus 2973 show distinctive sequence features compared to slower-growing relatives like Synechococcus 7942

    • These variations may represent adaptations to specific light conditions, temperature ranges, or nutrient availabilities

  • Functional Domain Conservation:

    • Transmembrane regions show higher conservation than cytoplasmic domains

    • Residues involved in protein-protein interactions with other ATP synthase subunits are typically more conserved

    • Variable regions may indicate areas less critical for function or subject to selection for specific environmental adaptations

  • Evolutionary Rate Analysis:

    • atpF shows different evolutionary rates compared to other ATP synthase subunits

    • This differential rate supports the theory that b and b' arose from gene duplication followed by divergent evolution

    • Analysis of synonymous vs. non-synonymous substitutions can identify regions under positive selection

  • Structure-Function Relationships:

    • Correlating sequence variations with known structural features can identify critical functional regions

    • For example, variations in the C-terminal region might affect interaction with the delta subunit of F1

    • N-terminal variations could influence membrane insertion and interaction with other F0 components

Phylogenetic analysis has shown that ATP synthase components from most Synechococcus species cluster together, but have evolved from their common ancestor into distinct groups . Interestingly, the ATP synthase alpha subunit (AtpA) in Synechococcus 7942 contains a cysteine at position 252, while 88.95% of cyanobacterial AtpA homologs have a conserved tyrosine at this position . This suggests that similar unique variations might exist in atpF across different strains, potentially contributing to their specific physiological characteristics.

How does the study of recombinant ATP synthase components like atpF contribute to our understanding of photosynthetic energy conversion?

The study of recombinant ATP synthase components, including atpF, provides critical insights into photosynthetic energy conversion:

  • Mechanistic Understanding of the Energy Conversion Process:

    • ATP synthase represents the final step in photosynthetic energy conversion

    • The b subunit (atpF) plays a key structural role in coupling proton movement to ATP synthesis

    • Recombinant studies allow precise manipulation of this coupling mechanism

  • Integration with Electron Transport Processes:

    • ATP synthase activity directly affects the proton gradient established by photosynthetic electron transport

    • This gradient influences electron flow through both photosystems

    • Experimental manipulation of atpF can reveal how structural changes affect this energetic balance

  • Regulatory Mechanisms Across Systems:

    • Research on ATP synthase has revealed regulatory connections between:

      • Light harvesting complexes

      • Electron transport components

      • Carbon fixation machinery

    • These connections provide a systems-level understanding of photosynthetic regulation

  • Evolutionary Adaptations in Energy Coupling:

    • Comparative studies of recombinant atpF from different sources highlight evolutionary solutions to energetic challenges

    • These adaptations offer insights into how organisms optimize energy conversion under varying conditions

Studies of ATP synthase mutations have demonstrated that single amino acid changes can significantly impact photosynthetic efficiency. For example, the C252Y mutation in ATP synthase subunit alpha leads to increased AtpA protein levels, higher intracellular ATP synthase activity, and improved photosystem II activity under heat stress conditions , illustrating the close coupling between ATP synthesis and photosynthetic function.

What insights from atpF research might be applicable to understanding human mitochondrial ATP synthase disorders?

Despite evolutionary divergence, research on cyanobacterial ATP synthase subunit b provides valuable insights applicable to human mitochondrial ATP synthase disorders:

  • Structural and Functional Conservation:

    • F-type ATP synthases share fundamental structural features across all domains of life

    • Though sequence homology between cyanobacterial atpF and human ATP synthase subunit b is limited, the functional roles have similarities

    • Both form critical components of the peripheral stalk that connects F1 and F0 domains

  • Disease-Relevant Mechanisms:

    • Studies of how mutations in cyanobacterial atpF affect:

      • ATP synthase assembly

      • Proton translocation efficiency

      • Energy coupling between F0 and F1

    • These provide models for understanding similar processes in mitochondrial disorders

  • Experimental Advantages:

    • Cyanobacterial systems offer experimental advantages:

      • Easier genetic manipulation

      • Recombinant protein production is simpler

      • Higher-resolution structural studies are often more achievable

    • Findings can generate hypotheses later tested in mammalian systems

  • Therapeutic Strategy Development:

    • Understanding how cyanobacteria optimize ATP synthase function under stress

    • Identifying small molecules that stabilize ATP synthase structure or enhance activity

    • These approaches could inspire therapeutic strategies for mitochondrial disorders

While direct application requires caution due to evolutionary divergence, the fundamental mechanisms of ATP synthesis are conserved. For instance, both systems rely on the rotation of central subunits driven by proton flow, with peripheral stalks providing the counter-force necessary for energy coupling. Insights into how structural changes in cyanobacterial ATP synthase subunits affect this process can provide valuable conceptual frameworks for understanding mitochondrial ATP synthase dysfunction.

What are the latest techniques for studying the structural dynamics of ATP synthase subunit b in membrane environments?

Recent methodological advances have significantly enhanced our ability to study structural dynamics of membrane proteins like ATP synthase subunit b:

  • Advanced Membrane Mimetics:

    • Nanodiscs: Lipid bilayers surrounded by scaffold proteins that provide a native-like environment

    • Styrene maleic acid lipid particles (SMALPs): Allow extraction of membrane proteins with surrounding lipids

    • These systems maintain the structural integrity of atpF better than traditional detergent solubilization

  • High-Resolution Structural Methods:

    • Cryo-electron microscopy (cryo-EM): Recent advances allow near-atomic resolution of membrane protein complexes

    • Solid-state NMR: Provides dynamic information about membrane proteins in lipid environments

    • X-ray free-electron laser (XFEL) crystallography: Allows structural determination with minimal radiation damage

  • Single-Molecule Techniques:

    • Fluorescence resonance energy transfer (FRET): Measures distances between labeled positions during functional cycles

    • Atomic force microscopy (AFM): Provides topographical information and mechanical properties

    • These techniques can capture conformational changes during ATP synthesis/hydrolysis

  • Computational Methods:

    • Molecular dynamics simulations: Model protein behavior in realistic membrane environments

    • Enhanced sampling techniques: Capture rare conformational transitions

    • Coarse-grained simulations: Model longer timescale dynamics of large membrane protein complexes

  • Hybrid Approaches:

    • Integrating data from multiple experimental techniques

    • Computational modeling constrained by experimental data

    • These provide more comprehensive structural and dynamic information than any single method

These methods have revealed that the b subunit, rather than being a rigid rod as previously thought, has considerable flexibility that may be important for accommodating the conformational changes that occur during ATP synthesis .

What approaches can researchers use to study the interaction between atpF and the unique regulatory mechanisms in cyanobacterial ATP synthase?

Cyanobacterial ATP synthase has unique regulatory mechanisms compared to other bacterial and eukaryotic ATP synthases. Several approaches can be used to study how atpF participates in these regulatory processes:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.