Recombinant Synechococcus sp. ATP synthase subunit b' (atpG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
atpF2; atpG; Syncc9902_0485; ATP synthase subunit b'; ATP synthase F(0 sector subunit b'; ATPase subunit II; F-type ATPase subunit b'; F-ATPase subunit b'
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Synechococcus sp. (strain CC9902)
Target Names
atpG
Target Protein Sequence
MTWLLLAEAGVPEGGLFDLDATLPLMAVQVVLLTFLLNALFFRPVGKVVEDREGFISTSR ADAKQKLAQVERLEADLAEQLKGARQAVQSVIVDAEQEVDGLYREALAQAEAEANRTKEE SRRGIEAERESARAQLKGKVDQLSTTIIDRLLAA
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 catalytic core (extramembraneous) and the F0 membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. The b'-subunit is a component of the F0 channel and forms part of the peripheral stalk, connecting F1 and F0. In plants and photosynthetic bacteria, b' is a diverged and duplicated form of the b subunit.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cellular thylakoid membrane; Single-pass membrane protein.

Q&A

What is the structural organization of ATP synthase genes in Synechococcus sp.?

The genes encoding ATP synthase subunits in Synechococcus are strategically organized at three separate genomic loci. Six genes form one cluster in the order a:c:b':b:delta:alpha, while the genes for beta and epsilon subunits constitute a second separate cluster. The gene encoding the gamma subunit is located at a third distinct site . This organization is evolutionarily significant as it bears similarity to the arrangement of ATP synthase genes in plastid genomes of higher plants, particularly red algae and diatoms, supporting the endosymbiotic theory of chloroplast origin .

What is the amino acid composition of the atpG protein in different Synechococcus strains?

The atpG protein varies slightly among Synechococcus strains:

StrainProtein LengthUniProt IDKey Features
Synechococcus sp. (B1XHZ1)161 aaB1XHZ1N-terminal His-tag for purification
Synechococcus sp. (A5GV75)155 aaA5GV75Higher proportion of hydrophobic amino acids
Synechococcus sp. (Q2JIF7)157 aaQ2JIF7From strain JA-2-3B'a(2-13)

The b' subunit (atpG) in all strains contains hydrophobic regions essential for membrane anchoring and a more hydrophilic domain involved in interactions with other ATP synthase subunits .

How does the b' subunit contribute to ATP synthase function?

The b' subunit (atpG) serves as a critical structural component of the F0 portion of ATP synthase. It forms part of the peripheral stalk that connects the membrane-embedded F0 sector with the catalytic F1 sector. This connection is essential for maintaining the structural integrity of the complex during the rotational catalysis that drives ATP synthesis .

While less studied than other subunits like a, c, or those in the F1 sector, the b' subunit contributes to the stability of the complex and potentially plays a role in regulating enzyme activity by supporting the conformational changes that occur during catalysis .

What methodologies are most effective for expressing and purifying recombinant atpG protein?

Based on current research practices, the following protocol is recommended:

Expression System Selection:
E. coli is the preferred heterologous expression system due to its high yield and relative simplicity . The protein is typically expressed with an N-terminal His-tag to facilitate purification.

Optimized Expression Conditions:

  • Culture in LB medium supplemented with appropriate antibiotics

  • Induction with IPTG (0.5-1.0 mM) at OD600 of 0.6-0.8

  • Post-induction growth at lower temperatures (16-25°C) for 16-18 hours to enhance proper folding

Purification Strategy:

  • Cell lysis using sonication in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, and 10 mM imidazole

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

  • Washing with increasing imidazole concentrations (20-50 mM)

  • Elution with higher imidazole (250-300 mM)

  • Size exclusion chromatography for higher purity

Storage Recommendations:
The purified protein should be stored in Tris/PBS-based buffer with 50% glycerol at -20°C or -80°C for extended storage . Working aliquots can be maintained at 4°C for up to one week .

How can researchers assess interactions between atpG and other ATP synthase subunits?

Several complementary approaches can be employed:

Protein-Protein Interaction Studies:

  • Co-immunoprecipitation (Co-IP): Using antibodies against tagged atpG to pull down interacting partners, followed by western blot or mass spectrometry analysis.

  • Yeast Two-Hybrid (Y2H) Assays: For detecting binary interactions between atpG and other subunits.

  • Blue Native PAGE: To analyze intact ATP synthase complexes and subcomplexes.

Structural Analysis:
Cross-linking studies combined with mass spectrometry can map interaction interfaces between atpG and other subunits, particularly the a (atpB) and c (atpE) subunits, which show strong binding to regulatory elements .

Functional Validation:
Reconstitution experiments using purified subunits can confirm the assembly of functional complexes. The interaction between atpG and other subunits can be assessed through measurements of ATP hydrolysis activity using methods similar to those described in research with AtpΘ inhibitor peptides .

What is the significance of specific mutations in ATP synthase subunits for stress tolerance?

Research has demonstrated that targeted mutations in ATP synthase subunits can significantly enhance stress tolerance in cyanobacteria:

Case Study: C252Y Mutation in AtpA:
A single amino acid substitution (C252Y) in the α subunit of F0F1 ATP synthase (AtpA) markedly improves stress tolerance in Synechococcus elongatus UTEX 2973 compared to PCC 7942 . This mutation:

  • Increases AtpA protein levels under both normal and stress conditions

  • Enhances intracellular F0F1 ATP synthase activity

  • Elevates intracellular ATP abundance under stress conditions

  • Upregulates transcription of photosystem II genes, particularly psbA2

  • Improves photosystem II activity

  • Promotes glycogen accumulation

Mechanistic Insights:
Site-saturation mutagenesis experiments revealed that substituting cysteine 252 with any of four conjugated amino acids (Y, W, F, H) significantly improved stress tolerance, with the mechanism involving:

  • Enhanced ATP synthase stability under heat stress

  • Increased ATP production under high light and high temperature conditions

  • Better maintenance of energy balance during environmental stress

This research provides valuable targets for metabolic engineering to improve cyanobacterial stress tolerance for biotechnological applications.

How do inhibitory proteins regulate ATP synthase activity in cyanobacteria?

Recent research has identified AtpΘ as a specific inhibitor of ATP synthase in cyanobacteria, functioning as an analogous mechanism to the IF1 protein in mitochondria:

Regulation Mechanism:
AtpΘ binds to the ATP synthase complex and inhibits ATP hydrolysis activity in a dose-dependent manner, with inhibitory effects comparable to the chemical inhibitor DCCD (dicyclohexylcarbodiimide) .

Experimental Evidence:

  • Membrane fractions from wild-type Synechocystis 6803 show significantly higher ATPase activity when grown in light compared to dark incubation

  • Knockout strains lacking AtpΘ (ΔatpT) show no significant difference between light and dark conditions

  • Addition of synthetic AtpΘ peptide to isolated membrane fractions or purified ATP synthase decreases ATPase activity by approximately 40%

Physiological Role:
AtpΘ prevents wasteful ATP hydrolysis when the proton gradient is weakened, particularly during dark periods when photosynthesis is inactive. This regulation is critical for energy conservation in cyanobacteria and represents an important adaptation for survival under fluctuating light conditions .

Interaction Partners:
Protein-protein interaction studies demonstrate that AtpΘ shows strongest binding toward subunit a (atpB) and subunit c (atpE) of the ATP synthase complex, suggesting its regulatory action occurs through interaction with the F0 sector .

What methodologies are available for measuring ATP synthase activity in cyanobacterial samples?

Researchers can employ several complementary approaches:

1. ATP Hydrolysis Activity Assays:

  • Phosphate Release Method: Measures inorganic phosphate released during ATP hydrolysis using colorimetric detection with malachite green or molybdate

  • Coupled Enzyme Assay: Links ATP hydrolysis to NADH oxidation through pyruvate kinase and lactate dehydrogenase, monitored spectrophotometrically at 340 nm

Protocol for Membrane Fraction ATP Hydrolysis Assay:

  • Isolate membrane fractions from cyanobacterial cells through differential centrifugation

  • Incubate membrane fractions (50-100 μg protein) with ATP (2-5 mM) in assay buffer (50 mM Tris-HCl pH 8.0, 5 mM MgCl2)

  • Monitor inorganic phosphate release over time (15-30 minutes)

  • Calculate activity as μmol Pi released per minute per mg protein

  • To confirm ATP synthase-specific activity, include control reactions with specific inhibitors (e.g., DCCD at 40-100 μM)

2. ATP Synthesis Activity Measurement:

  • Luciferase-Based Assay: Measures ATP production in real-time using the luciferin-luciferase system

  • HPLC Analysis: Quantifies ATP generated from ADP and inorganic phosphate

3. Analysis of Purified ATP Synthase:
For more detailed mechanistic studies, ATP synthase can be purified using affinity tags:

  • Engineer cyanobacterial strains expressing tagged ATP synthase subunits (e.g., 3xFLAG tag on AtpB)

  • Purify using anti-FLAG affinity chromatography

  • Verify purity by SDS-PAGE and immunoblotting

  • Measure activity of the purified complex with various modulators

This approach allows direct assessment of effects from inhibitors, activators, or site-directed mutations.

How does environmental stress affect ATP synthase gene expression and activity in cyanobacteria?

Environmental stressors significantly impact ATP synthase expression and function:

Light/Dark Transitions:

  • Expression of the atpT gene (encoding the ATP synthase inhibitor AtpΘ) is induced under darkness

  • The inhibitory mechanism prevents wasteful ATP hydrolysis when the proton gradient is weakened

  • This regulation can be prevented by adding glucose, which stimulates respiration-dependent ATP synthesis

Temperature Stress:

Cell-Type Specific Regulation:
In filamentous cyanobacteria like Nostoc 7120, atpT expression is shut down in heterocysts (specialized nitrogen-fixing cells) where high respiration rates maintain ATP production without photosystem II activity .

Methodological Approach for Studying Environmental Effects:

  • Culture cyanobacteria under controlled stress conditions (varying light intensity, temperature, nutrient availability)

  • Isolate RNA for transcriptomic analysis of ATP synthase genes

  • Prepare membrane fractions for biochemical assays of ATP synthase activity

  • Use fluorescent protein fusions to track expression patterns in different cell types or under various conditions

  • Measure intracellular ATP levels using luciferase-based assays to correlate with ATP synthase activity

How might structural biology approaches advance our understanding of atpG function?

Current Limitations and Opportunities:
While crystal structures are available for the F1 portion of ATP synthase from various organisms, detailed structural information about the membrane-embedded F0 sector, including the b' subunit (atpG), remains limited for cyanobacterial ATP synthase.

Promising Approaches:

  • Cryo-Electron Microscopy (cryo-EM): Recent advances in cryo-EM resolution make it feasible to determine the structure of intact ATP synthase complexes, including the orientation and interactions of atpG.

  • Cross-linking Mass Spectrometry: This approach can map interaction interfaces between atpG and other subunits, providing insights into the assembly and regulation of the complex.

  • Molecular Dynamics Simulations: Using available structural data and homology models to simulate the dynamics of atpG within the membrane environment and its interactions with other subunits.

What are the implications of ATP synthase regulation for bioenergy applications?

Understanding the regulatory mechanisms of cyanobacterial ATP synthase, particularly through proteins like AtpΘ and beneficial mutations like C252Y in AtpA, has significant implications for:

Future research investigating the structure-function relationships of atpG and other ATP synthase subunits will be crucial for realizing these applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.