Recombinant Synechococcus sp. Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Cobalamin Dependency in Synechococcus sp.

Synechococcus sp. strain PCC 7002 is a cobalamin auxotroph, relying on exogenous vitamin B12 for methionine biosynthesis via the cobalamin-dependent methionine synthase (MetH) . Key findings include:

  • Methionine Synthase Requirement: MetH catalyzes methyl transfer from N5-methyltetrahydrofolate to homocysteine, requiring methylcobalamin as a cofactor .

  • Auxotrophy Relief: Complementation with the metE gene (encoding cobalamin-independent methionine synthase) from Synechococcus sp. PCC 73109 eliminated B12 dependency, enabling autotrophic growth .

Cobalamin Transport Systems

Synechococcus sp. employs TonB-dependent transporters (e.g., BtuB1/BtuB2) and ABC transporters (BtuC/D/F) for B12 uptake, regulated by cobalt availability . Key data:

GeneFunctionRegulationPhenotype
btuB2High-affinity cobalamin uptakeActive under low cobaltReduced uptake in ΔbtuB2 mutants
btuB1Standard cobalamin uptakeActive under sufficient cobaltMild phenotype in ΔbtuB1 mutants
tonB3Energy transduction for transportCobalamin-dependent60% reduced uptake in ΔtonB3
btuDATPase for ABC transporterCobalamin riboswitch-regulatedCritical for transport efficiency

Cobalamin Riboswitches and Regulation

  • Transcriptional Attenuation: The btu operon in Synechococcus sp. PCC 7002 contains a B12 box riboswitch, reducing transcript levels by 20–250× in the presence of exogenous cobalamin .

  • Riboswitch Applications: A cobalamin-repressible system was engineered using the metE promoter riboswitch from Synechococcus sp. PCC 73109, enabling controlled gene expression .

Genomic and Metabolic Context

  • Cobalamin Utilization: Synechococcus sp. PCC 7002 uses B12 solely for MetH, with no other known enzymatic dependencies .

  • Evolutionary Adaptation: The lack of cob operon genes in this strain contrasts with cobalamin-producing bacteria, explaining its auxotrophy .

Research Implications

While recombinant cobS from Synechococcus sp. remains uncharacterized in the available literature, the above systems highlight:

  • Biotechnological Potential: Engineering autotrophic Synechococcus strains via metE insertion .

  • Regulatory Tools: Cobalamin riboswitches enable tunable gene expression for metabolic engineering .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include your preferred format in order notes for tailored preparation.
Lead Time
Delivery time may vary based on your purchase method and location. Please consult your local distributors for accurate delivery estimates.
Note: Our standard shipping includes blue ice packs. For dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term stability, we recommend adding 5-50% glycerol (final concentration) and storing aliquots at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference for your convenience.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms exhibit a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended to minimize freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. Should you have a specific tag type in mind, please inform us, and we will prioritize its implementation.
Synonyms
cobS; syc1064_d; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
full length protein
Species
Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)
Target Names
cobS
Target Protein Sequence
MIRQLWTELNAAILFYTVLPLPQRWPTQFAGMSRWAPIVGLILGLILAVSDRLLAVGQFP LPLRSLLIVLLAIALTGGLHLDGAMDTADGLAVPNPDRRLEVMSDSHTGAFGAIAAIAII SLKTIALCYLPAPRSLLILLIPVWGRWAQVLAIVRYPYLKAEGKGAIHKQTGRGAIDLLP GAIALVLGIGAIARFHSLTVALQLLAIGLLWAWATGAWLQKKLGGQTGDTYGAIVEWTEA LIWVSFTIGQV
Uniprot No.

Target Background

Function
Catalyzes the synthesis of adenosylcobalamin (Ado-cobalamin) by combining adenosylcobinamide-GDP and alpha-ribazole. This enzyme also synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Why is Synechococcus sp. strain PCC 7002 dependent on exogenous cobalamin?

Synechococcus sp. strain PCC 7002 has an obligate requirement for exogenous cobalamin because it lacks the complete genetic machinery for de novo cobalamin synthesis . This cyanobacterium uses cobalamin exclusively as a cofactor for methionine synthase (MetH), which catalyzes the transfer of a methyl group for methionine biosynthesis . The obligate requirement for cobalamin is shared by various cyanobacteria encompassing the genera Dermocarpa, Synechocystis, and Pleurocapsa, as well as other Synechococcus species . Genetic complementation studies have demonstrated that the cobalamin auxotrophy of Synechococcus sp. strain PCC 7002 can be alleviated by introducing the metE gene (encoding cobalamin-independent methionine synthase) from closely related cyanobacteria, confirming that methionine biosynthesis is likely the sole use of cobalamin in this organism .

How does Synechococcus sp. acquire and transport cobalamin?

Synechococcus sp. strain PCC 7002 possesses a specialized active transport system for cobalamin uptake, which is necessary due to the large size of this tetrapyrrole compound . The transport system is encoded by a btuB-cpdA-btuC-btuF operon . The components of this transport system were initially misidentified as encoding subunits of a siderophore transporter but were later correctly identified as components of cobalamin uptake through experimental validation using a cobalamin-regulated reporter system . The expression of these genes is controlled by a cobalamin riboswitch that acts as a transcriptional attenuator, allowing the organism to regulate cobalamin uptake based on intracellular cobalamin concentrations .

What methodological approaches can be used to express and purify recombinant cobS in heterologous systems when working with Synechococcus genes?

When expressing recombinant cobS from Synechococcus species in heterologous systems (e.g., E. coli), researchers should consider the following methodological approach:

  • Gene identification and cloning: Identify potential cobS sequences through bioinformatic analysis comparing related cyanobacterial species that can synthesize cobalamin. Use BLASTP and other homology searching tools similar to those described for identifying MetE in related Synechococcus strains .

  • Expression vector selection: Choose a vector system with an inducible promoter (e.g., T7 or tac promoter) and appropriate tags for purification (His6, GST, or MBP tags).

  • Codon optimization: Codon-optimize the cobS sequence for the expression host to improve protein yield, especially important for cyanobacterial genes expressed in E. coli.

  • Expression conditions: Test expression under various conditions:

    • Temperature: 18°C, 25°C, 30°C, and 37°C

    • Induction time: 4h, 8h, overnight

    • Inducer concentration: 0.1-1.0 mM IPTG

    • Media: LB, TB, or minimal media supplemented with cobalt ions

  • Purification protocol:

    • Lysis buffer optimization (typically containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 1 mM DTT)

    • Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

    • Size exclusion chromatography for final purification

    • Include cobalt salts (0.1-1 mM) in buffers to stabilize the enzyme

  • Activity assays: Develop spectrophotometric assays to measure cobS activity based on substrate consumption or product formation, typically monitoring absorbance changes at specific wavelengths related to cobalamin intermediates.

How can one establish a cobalamin-repressible gene expression system in Synechococcus sp. using the identified cobalamin riboswitches?

To establish a cobalamin-repressible gene expression system in Synechococcus sp., researchers can utilize the natural cobalamin riboswitches present in the organism. Based on the available information, a methodological approach would include:

  • Identification of suitable riboswitches: Two cobalamin riboswitches have been identified in Synechococcus sp.: one in the promoter region of metE and another in the promoter region of the btuB-cpdA-btuC-btuF operon . Analysis of the promoter regions containing these riboswitches is essential for system design.

  • Construction of expression vectors:

    • Amplify the promoter region containing the cobalamin riboswitch (e.g., the 564-bp region upstream of btuB)

    • Transcriptionally fuse this promoter to a reporter gene (e.g., yfp) or your gene of interest

    • Clone this construct into an appropriate expression vector for Synechococcus sp.

  • Transformation and selection:

    • Transform the construct into Synechococcus sp. using established protocols

    • Select transformants using appropriate antibiotics

    • Verify integration by PCR or sequencing

  • System validation:

    • Culture the transformants in media with and without exogenous cobalamin

    • Measure expression levels of the reporter gene or protein of interest

    • Validate that expression is repressed in the presence of cobalamin and induced in its absence

  • System optimization:

    • Test different cobalamin concentrations to determine the dose-response relationship

    • Modify the riboswitch sequence if necessary to adjust sensitivity or dynamic range

    • Integrate the system with other genetic tools for more complex regulation

This approach has been successfully demonstrated with the development of a cobalamin-repressible yellow fluorescent protein reporter system in a Synechococcus sp. strain PCC 7002 variant .

What factors affect the functionality and stability of recombinant cobS in experimental settings?

Several factors can affect the functionality and stability of recombinant cobS in experimental settings:

  • Cofactor availability:

    • Cobalt ions are essential for cobS activity as they are incorporated into the corrin ring

    • ATP is required for the enzymatic reaction

    • Ensure supplementation of growth media and reaction buffers with CoCl₂ (typically 0.1-1 mM)

  • Redox conditions:

    • Maintain appropriate redox environment during purification and storage

    • Include reducing agents like DTT (1-5 mM) or β-mercaptoethanol (5-10 mM)

    • Consider oxygen sensitivity; perform reactions in anaerobic chambers if necessary

  • pH and temperature stability:

    • Optimize pH conditions (typically pH 7.5-8.5 for cyanobacterial enzymes)

    • Determine thermal stability profile through activity assays at various temperatures

    • Store enzyme preparations at -80°C with glycerol (10-20%) as a cryoprotectant

  • Protein solubility and aggregation:

    • Monitor protein solubility during expression and purification

    • Consider fusion partners (e.g., MBP) to enhance solubility

    • Use dynamic light scattering to assess aggregation propensity

  • Post-translational modifications:

    • Heterologous expression systems may lack necessary PTMs present in native organisms

    • Consider expression in cyanobacterial hosts for authentic modifications

  • Reaction product inhibition:

    • High concentrations of cobalamin may inhibit cobS activity through feedback mechanisms

    • Design experiments with appropriate substrate/product ratios

How can one design experiments to investigate the potential secondary functions of cobS in Synechococcus sp. beyond cobalamin synthesis?

To investigate potential secondary functions of cobS in Synechococcus sp. beyond cobalamin synthesis, the following experimental design approach is recommended:

  • Comparative genomics and proteomics:

    • Perform phylogenetic analysis of cobS across cyanobacterial species

    • Identify conserved domains and potential moonlighting functions through bioinformatic analysis

    • Look for protein-protein interaction networks involving cobS

  • Heterologous expression and complementation:

    • Express cobS from cobalamin-producing cyanobacteria in Synechococcus sp. PCC 7002

    • Assess phenotypic changes beyond cobalamin auxotrophy

    • Perform growth assays under various stress conditions (light, temperature, salinity)

  • Protein interaction studies:

    • Conduct pull-down assays using tagged cobS to identify interaction partners

    • Employ bacterial two-hybrid systems to verify specific interactions

    • Perform co-immunoprecipitation followed by mass spectrometry analysis

  • Metabolomic profiling:

    • Compare metabolite profiles between wild-type and cobS-expressing strains

    • Focus on pathways beyond methionine synthesis

    • Use stable isotope labeling to track metabolic flux

  • Transcriptomic analysis:

    • Perform RNA-seq to identify genes differentially expressed upon cobS introduction

    • Look for enrichment of specific pathways or biological processes

    • Validate findings with RT-qPCR for selected genes

  • Structural biology approaches:

    • Determine the crystal structure of cobS to identify potential binding sites for unexpected ligands

    • Perform in silico docking studies with various metabolites

    • Use mutagenesis to test the importance of specific residues for potential secondary functions

What experimental approaches can be used to study the regulation of cobS expression in relation to cobalamin riboswitches?

To study the regulation of cobS expression in relation to cobalamin riboswitches, researchers can employ the following experimental approaches:

  • Reporter gene assays:

    • Construct transcriptional fusions between putative riboswitch-containing promoters and reporter genes (yfp, lacZ)

    • Compare expression levels in the presence and absence of cobalamin

    • Create riboswitch variants with mutations in key structural elements (as done with the btuB riboswitch where a double cytosine-to-thymine transition variant was created)

  • RNA structure analysis:

    • Perform in-line probing or SHAPE (Selective 2′-hydroxyl acylation analyzed by primer extension) to determine RNA conformational changes upon cobalamin binding

    • Use RNA footprinting to identify cobalamin binding sites

    • Employ native gel electrophoresis to visualize riboswitch conformational changes

  • Transcriptional profiling:

    • Perform RNA-seq to quantify global transcriptional changes in response to cobalamin availability

    • Focus on genes potentially regulated by cobalamin riboswitches

    • Compare results between wild-type and riboswitch-mutant strains

  • In vitro transcription assays:

    • Set up in vitro transcription systems with purified RNA polymerase

    • Test the effect of cobalamin on transcription termination at riboswitch-containing templates

    • Compare wild-type and mutant riboswitch sequences

  • Riboswitch-mediated translation regulation:

    • Develop in vitro translation systems to test if riboswitches affect translation initiation

    • Create translational fusions with reporter genes to assess effects in vivo

  • Binding affinity measurements:

    • Determine cobalamin binding affinity to riboswitches using isothermal titration calorimetry (ITC)

    • Perform competition assays with structural analogs of cobalamin

    • Compare binding properties across different cyanobacterial species

How can one design experiments to address contradictions in data regarding cobS functionality in different Synechococcus strains?

When addressing contradictions in data regarding cobS functionality across different Synechococcus strains, a systematic experimental approach is necessary:

  • Standardization of experimental conditions:

    • Define consistent growth conditions (media composition, light intensity, temperature)

    • Standardize protein expression and purification protocols

    • Use the same activity assay methods across all strains being compared

  • Comparative genomics approach:

    • Sequence and compare the cobS gene and surrounding genomic regions from multiple strains

    • Identify potential sequence variations that might explain functional differences

    • Construct a comprehensive phylogenetic tree of cobS across cyanobacterial species

  • Complementation experiments:

    • Express cobS from different strains in a common heterologous host

    • Test complementation of cobS-deficient organisms

    • Assess cross-complementation between different Synechococcus strains

  • Domain swapping and mutagenesis:

    • Create chimeric cobS proteins containing domains from different strains

    • Introduce specific mutations based on sequence differences

    • Test activity of mutant proteins to identify critical residues

  • Metabolic context analysis:

    • Characterize the broader cobalamin metabolism in each strain

    • Identify potential differences in accessory proteins or regulatory elements

    • Measure intracellular concentrations of cobalamin and related metabolites

  • Independent validation:

    • Have multiple laboratories independently verify key findings

    • Use different experimental approaches to test the same hypothesis

    • Implement blind experimental designs to minimize bias

  • Data reproduction assessment:

    • Evaluate statistical power and sample sizes in contradictory studies

    • Assess reproducibility of key experiments under identical conditions

    • Identify potential confounding variables that might explain discrepancies

What are the optimal conditions for assaying recombinant Synechococcus cobS activity in vitro?

The optimal conditions for assaying recombinant Synechococcus cobS activity in vitro typically include:

Buffer composition and pH:

  • 50 mM Tris-HCl or HEPES buffer, pH 7.5-8.0

  • 150-300 mM NaCl for ionic strength

  • 5-10% glycerol for protein stability

  • 1-5 mM MgCl₂ (cofactor for ATP hydrolysis)

  • 0.1-1 mM CoCl₂ (essential metal ion)

  • 1-5 mM DTT or 2-mercaptoethanol (reducing agent)

Substrate concentrations:

  • Hydrogenobyrinic acid a,c-diamide (HBAD): 10-50 μM

  • ATP: 1-5 mM

  • Glutamine or ammonium source: 1-10 mM

Reaction conditions:

  • Temperature: 25-30°C (optimal for cyanobacterial enzymes)

  • Incubation time: 30-60 minutes

  • Light conditions: Minimal exposure to bright light (protect photosensitive cobalamin intermediates)

  • Anaerobic or micro-aerobic conditions may improve activity

Activity measurement methods:

  • HPLC analysis of reaction products

  • Spectrophotometric monitoring of cobalamin formation (350-550 nm range)

  • Coupled enzyme assays tracking ATP consumption

  • LC-MS/MS for precise quantification of reaction intermediates and products

Controls to include:

  • Heat-inactivated enzyme control

  • No-substrate controls

  • Known cobS inhibitors (e.g., EDTA to chelate metals)

  • Positive control using commercially available cobS (if available)

What techniques are available for detecting and quantifying cobalamin and its precursors in Synechococcus cultures?

Multiple analytical techniques are available for detecting and quantifying cobalamin and its precursors in Synechococcus cultures:

  • High-Performance Liquid Chromatography (HPLC):

    • Reverse-phase HPLC using C18 columns

    • Mobile phase typically containing methanol/water gradient

    • UV-visible detection at multiple wavelengths (361 nm for cobalamin)

    • Fluorescence detection for naturally fluorescent corrinoid compounds

  • Mass Spectrometry:

    • LC-MS/MS for high sensitivity and specificity

    • Multiple reaction monitoring (MRM) for quantification

    • Time-of-flight MS for accurate mass determination

    • Sample preparation typically involves cell lysis, filtration, and solid-phase extraction

  • Microbiological Assays:

    • Cobalamin-dependent microorganisms (e.g., Salmonella enterica)

    • Growth response measured and compared to standard curves

    • Less specific but can detect biologically active cobalamin forms

  • Radioisotope Dilution Assays:

    • Using radioactively labeled cobalamin (⁵⁷Co or ⁶⁰Co)

    • Competitive binding with intrinsic factor or other cobalamin-binding proteins

    • Sensitivity to pg/mL levels

  • Colorimetric Assays:

    • Chemical conversion of cobalamin to a colored product

    • Spectrophotometric measurement at specific wavelengths

    • Limited specificity but useful for high-throughput screening

  • Biosensor-Based Methods:

    • Engineered bacteria containing cobalamin riboswitches fused to reporter genes

    • Fluorescence or luminescence readout proportional to cobalamin concentration

    • Can be designed with different sensitivity ranges

Sample extraction protocol:

  • Harvest cells by centrifugation (5,000 × g, 10 min, 4°C)

  • Wash cell pellet with phosphate buffer

  • Resuspend in extraction buffer (typically 50 mM phosphate buffer, pH 7.0)

  • Lyse cells by sonication or bead-beating

  • Heat treatment (100°C, 15 min) in the presence of KCN (0.1%)

  • Centrifuge to remove debris (15,000 × g, 15 min, 4°C)

  • Filter supernatant (0.22 μm)

  • Concentrate if necessary using solid-phase extraction

How can CRISPR-Cas9 gene editing be optimized for manipulating cobalamin biosynthesis genes in Synechococcus sp.?

Optimizing CRISPR-Cas9 gene editing for manipulating cobalamin biosynthesis genes in Synechococcus sp. requires attention to several critical factors:

  • Selection of CRISPR-Cas9 system:

    • Use cyanobacteria-optimized Cas9 variants or codon-optimized Cas9

    • Consider temperature-sensitive Cas9 variants (Synechococcus optimal growth at 30-38°C)

    • Alternative CRISPR systems (e.g., Cpf1/Cas12a) may offer advantages for AT-rich regions

  • sgRNA design considerations:

    • Target PAM sites specific to the Cas9 variant used (typically NGG for SpCas9)

    • Design multiple sgRNAs per target to maximize editing efficiency

    • Avoid targeting regions with secondary structure formation

    • Check for off-target sites across the Synechococcus genome

    • Use algorithms optimized for cyanobacterial genomes to predict sgRNA efficiency

  • Delivery methods:

    • Natural transformation if the strain is competent

    • Electroporation protocols optimized for cyanobacterial cells:

      • Cell density: OD₇₃₀ of 0.7-1.0

      • Voltage: 1.8-2.5 kV

      • Resistance: 400-800 Ω

      • Capacitance: 25-50 μF

    • Conjugation using helper E. coli strains for recalcitrant species

  • Homology-directed repair (HDR) template design:

    • Homology arm length: 500-1000 bp for optimal recombination

    • Include silent mutations in the PAM site or seed region to prevent re-cutting

    • Consider backbone modifications (phosphorothioate bonds) to increase template stability

  • Selection and screening strategies:

    • Antibiotic resistance markers suitable for cyanobacteria (e.g., kanamycin, spectinomycin)

    • Counter-selection systems (e.g., sacB for sucrose sensitivity)

    • Reporter genes (fluorescent proteins) for visual screening

    • PCR-based genotyping and sequencing for confirmation

  • Specific considerations for cobalamin genes:

    • When manipulating potential cobS genes, include complementation strategies to maintain viability:

      • Express functional cobS from a plasmid during editing

      • Provide exogenous cobalamin in the medium

    • For riboswitch editing, preserve the secondary structure elements essential for function

  • Efficiency optimization:

    • Multiple rounds of selection to enrich for edited cells

    • Reduced light intensity during recovery phase

    • Temperature optimization (30°C ideal for most Synechococcus strains)

    • Media supplementation with osmoprotectants during transformation

  • Verification methods:

    • Deep sequencing to quantify editing efficiency

    • Functional assays to confirm phenotypic changes

    • RT-qPCR to verify transcriptional changes

Comparative analysis of cobalamin-related gene expression in Synechococcus sp. strain PCC 7002

Table 1: Relative transcript abundance of cobalamin uptake genes in Synechococcus sp. strain PCC 7002 with and without exogenous cobalamin

GeneLocus TagFunctionRelative Transcript Level (Without Cobalamin)Relative Transcript Level (With Cobalamin)Fold Change
btuBSYNPCC7002_A0637Outer membrane cobalamin receptorHighLow249-fold decrease
cpdASYNPCC7002_A0636Periplasmic cobalamin-binding proteinHighLow~20-fold decrease
btuCSYNPCC7002_A0635Cobalamin transport permeaseHighLow~20-fold decrease
btuFSYNPCC7002_A0634Cobalamin transport system substrate-binding proteinHighLow~20-fold decrease
metHSYNPCC7002_A1053Cobalamin-dependent methionine synthaseModerateModerateNo significant change

This data, derived from global transcriptional profiling of a cobalamin-independent variant of Synechococcus sp. strain PCC 7002, demonstrates strong regulation of the btu operon by cobalamin availability . The dramatic 249-fold decrease in btuB transcript levels in the presence of exogenous cobalamin suggests that cobalamin uptake is tightly controlled by a cobalamin riboswitch . The differential regulation pattern, with btuB showing much stronger repression than the downstream genes, is consistent with transcriptional attenuation as the regulatory mechanism.

Structural elements of cobalamin riboswitches in Synechococcus sp.

Cobalamin riboswitches play a crucial role in regulating gene expression related to cobalamin metabolism in Synechococcus sp. Based on the research findings, two significant cobalamin riboswitches have been identified in Synechococcus sp.:

  • The metE riboswitch: Located in the promoter region of metE from Synechococcus sp. strain PCC 73109, this riboswitch acts as a cobalamin-dependent transcriptional attenuator .

  • The btuB riboswitch: Found in the promoter region of the btuB-cpdA-btuC-btuF operon in Synechococcus sp. strain PCC 7002, this riboswitch regulates cobalamin transport genes .

The btuB riboswitch contains key structural elements that are essential for its function:

  • A B12 box, which is a conserved region essential for cobalamin sensing

  • A putative terminator structure

  • A poly-U tract that facilitates transcription termination

  • P1 helix-B12 box interface, where mutations (CC to TT) disrupt riboswitch function

When cobalamin binds to the riboswitch, it induces a conformational change that leads to the formation of a terminator structure, resulting in premature transcription termination and reduced expression of downstream genes . Experimental validation using a yellow fluorescent protein reporter system confirmed the functionality of this riboswitch and demonstrated its potential for developing cobalamin-repressible gene expression systems in Synechococcus sp. .

What are the main technical challenges in expressing and studying recombinant cobS from Synechococcus sp.?

The main technical challenges in expressing and studying recombinant cobS from Synechococcus sp. include:

  • Protein solubility and stability issues:

    • Membrane association or hydrophobic regions may cause aggregation

    • Proper folding may require specific chaperones absent in heterologous hosts

    • Stability may depend on interactions with other proteins in the cobalamin synthesis pathway

  • Reconstitution of enzymatic activity:

    • Requirement for specific cofactors and metal ions

    • Need for appropriate redox environment

    • Potential dependency on other enzymes in the biosynthetic pathway

  • Substrate availability:

    • Limited commercial availability of cobS substrates (hydrogenobyrinic acid a,c-diamide)

    • Need to enzymatically synthesize substrates using precursor enzymes

    • Chemical instability of pathway intermediates

  • Assay development challenges:

    • Need for sensitive detection methods for cobalamin intermediates

    • Potential overlapping spectral properties of substrates and products

    • Optimization of reaction conditions for in vitro activity

  • Heterologous expression optimization:

    • Codon usage differences between cyanobacteria and common expression hosts

    • Different translational machinery and folding environment

    • Potential toxicity of overexpressed cobS to host cells

  • Strain-specific variations:

    • Genomic differences between Synechococcus strains affecting cobS functionality

    • Variable requirements for accessory proteins or cofactors

    • Differential regulation mechanisms across strains

What new research directions are emerging in understanding the evolution of cobalamin metabolism in cyanobacteria?

Emerging research directions in understanding the evolution of cobalamin metabolism in cyanobacteria include:

  • Comparative genomics of cobalamin biosynthesis pathways:

    • Mapping the presence/absence of cobalamin biosynthesis genes across cyanobacterial lineages

    • Identifying evolutionary events (gene loss, horizontal gene transfer) that shaped current distribution

    • Correlating metabolic capabilities with ecological niches

  • Co-evolution of riboswitches and metabolic pathways:

    • Investigating the evolutionary history of cobalamin riboswitches

    • Understanding how riboswitch diversity relates to regulatory needs

    • Exploring the potential of riboswitches as ancient regulatory elements predating protein-based regulation

  • Ecological implications of cobalamin auxotrophy:

    • Studying cobalamin exchange in microbial communities

    • Investigating symbiotic relationships between cobalamin producers and auxotrophs

    • Modeling how cobalamin dependency affects ecosystem dynamics

  • Metabolic adaptation to cobalamin limitation:

    • Characterizing alternative metabolic pathways that bypass cobalamin-dependent reactions

    • Studying the regulation of metE/metH switching in response to cobalamin availability

    • Investigating stress responses triggered by cobalamin limitation

  • Synthetic biology applications:

    • Developing engineered strains with enhanced or modified cobalamin metabolism

    • Creating synthetic regulatory circuits based on cobalamin riboswitches

    • Exploring biotechnological applications for cobalamin production or sensing

  • Ancestral sequence reconstruction:

    • Reconstructing ancient cobalamin biosynthesis enzymes

    • Testing functionality of predicted ancestral enzymes

    • Understanding the evolutionary trajectory from ancient to modern metabolic pathways

How might understanding cobS function contribute to broader applications in synthetic biology and metabolic engineering?

Understanding cobS function could contribute significantly to several areas of synthetic biology and metabolic engineering:

  • Enhanced cobalamin production:

    • Engineering cyanobacteria or other microorganisms for increased cobalamin synthesis

    • Optimizing cobS expression and activity to remove bottlenecks in the biosynthetic pathway

    • Developing strains that overproduce and excrete cobalamin for biotechnological applications

  • Creation of synthetic regulatory circuits:

    • Utilizing cobalamin riboswitches as modular regulatory elements in synthetic biology

    • Developing cobalamin-responsive genetic switches with tunable sensitivity

    • Creating feedback-regulated pathways using cobalamin sensing elements

  • Metabolic pathway engineering:

    • Introducing cobalamin-dependent pathways into organisms that naturally lack them

    • Engineering cobalamin-independent alternatives for essential metabolic reactions

    • Optimizing the balance between cobalamin synthesis and utilization in engineered organisms

  • Biosensor development:

    • Creating highly sensitive and specific cobalamin biosensors based on cobS or related proteins

    • Developing diagnostic tools for vitamin B12 deficiency

    • Environmental monitoring of cobalamin availability in aquatic ecosystems

  • Novel biocatalytic applications:

    • Exploiting the catalytic capabilities of cobS for chemoenzymatic synthesis

    • Engineering cobS variants with altered substrate specificity

    • Developing cobS-based biocatalysts for industrial applications

  • Photosynthetic efficiency improvement:

    • Understanding how cobalamin metabolism integrates with photosynthetic processes

    • Engineering optimized electron flow between photosynthesis and cobalamin metabolism

    • Improving carbon fixation efficiency through optimized metabolic network design

  • Biomedical applications:

    • Developing prokaryotic models for studying human cobalamin-related diseases

    • Engineering probiotics that produce and deliver cobalamin

    • Investigating cobalamin metabolism as a potential target for antimicrobial development

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.