Recombinant Synechococcus sp. Cytochrome b6 (petB)

Shipped with Ice Packs
In Stock

Description

Role in the Cytochrome b₆f Complex

Cytochrome b6 forms the core of the b₆f complex, partnering with subunit IV to create a quinone exchange portal. Structural studies reveal:

  • Proline residues at positions 105 and 112 in subunit IV induce helical bending, widening the plastoquinol entry channel .

  • Mutagenesis (e.g., Pro→Ala substitutions) reduces Synechococcus growth rates by 30–50% and impairs cytochrome f reduction kinetics .

Electron Transport Mechanism

  • Transfers electrons from plastoquinol to the Rieske Fe-S protein via a Q-cycle mechanism .

  • Critical for linking Photosystem II and I in cyanobacteria .

Heterologous Production

  • Vector Design: Full-length petB (UniProt IDs: Q3AUX3, Q7U4U6) cloned into E. coli vectors .

  • Yield: Milligram quantities obtained via affinity chromatography (Ni-NTA) .

  • Stability: Sensitive to freeze-thaw cycles; requires glycerol stabilization .

Sequence Variations

Strain/UniProt IDKey AA DifferencesSource
Q3AUX3 (Synechococcus sp.)Tyr-34, Ser-104, Glu-122
Q7U4U6 (Synechococcus sp.)Ser-34, Ser-104, Ser-122

These variations reflect strain-specific adaptations in quinone binding .

Biophysical Studies

  • Crystallography: Used to solve the 2.5 Å structure of the b₆f complex (PDB: 4OGQ) .

  • Isothermal Titration Calorimetry (ITC): Evaluates plastoquinone binding thermodynamics .

Mutagenesis and Functional Analysis

  • Proline-to-alanine substitutions in subunit IV alter portal aperture size, validating structural models of quinone trafficking .

  • Transcriptional profiling (qRT-PCR) shows petB expression remains stable under sulfide stress, unlike petA or petC .

Biotechnological Potential

  • Engineered b₆f complexes could enhance photosynthetic efficiency in synthetic biology .

  • Serves as a template for inhibitor screening (e.g., quinone analogues) .

Comparative Genomic Analysis

Freshwater Synechococcus strains (sub-cluster 5.2) exhibit:

  • Gene Content: Enriched carbohydrate/lipid metabolism genes vs. marine strains .

  • Photosynthesis Adaptations: Lack petL (cytochrome b₆f subunit 6) and plastocyanin (petE), relying solely on cytochrome c₆ .

FeatureSub-Cluster 5.2 StrainsMarine Strains
petB Conservation100%98%
petE PresenceAbsentPresent

Limitations and Future Directions

  • Stability Issues: Requires stringent storage conditions (-80°C) .

  • Functional Gaps: Interaction with cyclic electron transport proteins (e.g., PGRL1) remains unconfirmed .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
petB; CYA_1796; Cytochrome b6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime)
Target Names
petB
Target Protein Sequence
MSKVYDWLDERLEITPFVDDATGKFIPPHVNIFYCLGGITLVCFLIQFATGFAMTFYYRP TVAEAFESVNYIMTQVNFGWLLRSIHRWSASMMVLMMILHTFRVYLTGGFKKPRELTWVT GVILAVLTVSFGVTGYSLPWDQVGYWAVKIVSGVPSAIPVVGDALVQLIRGGEAVGQATL TRFYSLHTFVLPWLTAVFMTMHFLMIRRQGISGPL
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Database Links
Protein Families
Cytochrome b family, PetB subfamily
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the cytochrome b6 (petB) gene in Synechococcus sp. and what is its function?

The petB gene encodes the cytochrome b6 subunit of the cytochrome b6f complex, which plays an essential role in the photosynthetic electron transport chain of Synechococcus sp. This complex serves as an intermediate in electron transport between Photosystem II and Photosystem I. The cytochrome b6f complex receives electrons from Photosystem II and transfers them to either plastocyanin (encoded by petE) or cytochrome c6 (encoded by petJ), which then shuttle the electrons to Photosystem I .

The functional importance of cytochrome b6 is reflected in its high conservation across cyanobacterial species, making it an ideal candidate for taxonomic and evolutionary studies while still providing sufficient sequence variability to discriminate between closely related strains .

Why is petB used as a genetic marker for Synechococcus diversity studies?

The petB gene has emerged as a superior genetic marker for several compelling reasons:

  • High taxonomic resolution: Unlike the 16S rRNA gene, which does not provide sufficient molecular resolution to identify spatially structured populations of marine Synechococcus or 'ecotypes' adapted to distinct ecological niches, petB offers much finer discrimination between closely related strains .

  • Balanced sequence conservation and variation: The gene contains regions that are conserved enough for reliable primer design while displaying sufficient variation to distinguish between closely related lineages and subgroups .

  • Technical advantages: The relatively short sequence length, accurate automated alignment capabilities, and suitability for high-throughput sequencing make petB ideal for large-scale ecological and evolutionary studies .

  • Correlation with established classification systems: Multi-locus sequence analysis has shown that petB phylogeny correlates well with classifications based on other markers, providing a coherent taxonomic framework .

How does petB sequence variation correlate with Synechococcus ecological distribution?

Studies employing petB as a marker gene have revealed clear correlations between genetic diversity and ecological distribution patterns of Synechococcus populations across different marine environments. Environmental petB sequences cloned from contrasting sites have highlighted numerous genetically and ecologically distinct clusters .

Some of these clusters represent novel, environmentally abundant clades without cultured representatives, suggesting our current culture collections do not fully represent natural diversity . For example, metabarcoding studies using petB have distinguished between Synechococcus populations in subtropical (ST) and subantarctic (SA) water masses in the Southwest Pacific Ocean, revealing different dominant subclades (Ia, Ib, IVa, and IVb) associated with specific environmental conditions .

This ecological structuring demonstrates that petB can effectively identify ecotypes adapted to particular niches, providing insights into the factors driving Synechococcus evolution and distribution patterns.

What are the optimal methodological approaches for petB amplification and sequencing from environmental samples?

Several methodological approaches have been developed for petB amplification from environmental samples, with recent innovations addressing previous limitations:

Standard vs. Nested PCR Approaches:

The traditional approach (Mazard_2012) has been complemented by newer nested PCR methods (Ong_2022) that offer improved sensitivity and specificity. The newer method has successfully amplified petB from both filtered seawater samples and flow cytometry-sorted Synechococcus populations, with the latter only amplifiable using the nested approach .

Comparative Performance:
Both approaches recovered similar dominant subclades (Ia, Ib, IVa, and IVb) from filtered samples, but with some differences in relative abundance. For example:

  • In subtropical samples, subclade IVa appeared dominant using the Mazard_2012 approach.

  • The same samples processed with Ong_2022 showed similar contributions of subclades IVa and Ib .

The Ong_2022 nested PCR approach generally captured higher genetic diversity of Synechococcus subcluster 5.1 while producing a lower proportion of incorrectly assigned amplicon sequence variants (ASVs) .

Enhanced Primer Design:
Recent work has resulted in petB primer pairs that target both Prochlorococcus and Synechococcus communities, producing amplicons suitable for high-throughput sequencing platforms . This expanded coverage allows for more comprehensive ecological studies examining the co-occurrence and interactions between these important marine picocyanobacteria.

How can recombinant protein expression systems be optimized for heterologous gene expression in Synechococcus?

The pET expression system has been successfully adapted for Synechococcus elongatus to express heterologous proteins at high levels. This system employs the following components and optimization strategies:

Key Components:

  • T7 RNA polymerase: Inserted into the cyanobacterial genome under an inducible promoter.

  • T7 promoter (PT7): Controls the transcription of the heterologous gene of interest.

  • Inducible system: Typically uses a nickel-inducible promoter to control T7 RNA polymerase expression .

Expression Efficiency:
The pET system functions efficiently in S. elongatus, with nickel induction triggering T7 RNA polymerase expression, which then induces high-level expression of the gene of interest. In one study, after 24 hours of induction, T7 RNA polymerase expression increased approximately 5.5-fold over the uninduced timepoint, which was sufficient to raise heterologous gene expression by 22-fold .

Optimization Considerations:

  • Basal expression: Some basal expression may occur even without inducer addition, possibly due to the presence of divalent metal ions (Co2+, Zn2+, Cu2+) in standard growth media that can trigger certain promoters .

  • Induction timing: Optimal induction periods should be determined empirically for each recombinant protein.

  • Carbon conversion efficiency: Recombinant protein production in cyanobacteria can convert more than 50% of atmospheric CO2 into target proteins, making them efficient biofactories .

What approaches are most effective for analyzing petB sequence data from mixed Synechococcus populations?

Analysis of petB sequence data from mixed populations requires specialized bioinformatic approaches:

Amplicon Sequence Variant (ASV) Analysis:
Rather than traditional OTU-based methods, modern approaches to petB sequence analysis employ ASV identification, which provides single-nucleotide resolution. This is particularly valuable for petB, where small sequence variations can indicate ecologically distinct populations .

Reference Database Development:
Comprehensive reference databases of petB sequences from cultured isolates have been created, facilitating the taxonomic assignment of environmental sequences. These databases continue to expand as new isolates are characterized .

Multi-Locus Contextual Analysis:
While petB provides high resolution on its own, contextualizing findings with other marker genes or whole-genome analysis strengthens taxonomic and ecological inferences. Despite recognized lateral gene transfer in marine cyanobacteria, multi-locus sequence analysis of more than 120 isolates reflects a clonal population structure of major lineages and subgroups .

Phylogenetic Approaches:
The petB gene is particularly amenable to phylogenetic analysis due to its accurate automated alignment. Researchers typically use maximum likelihood or Bayesian inference approaches to construct phylogenetic trees that reveal relationships between sequences and environmental clusters .

What CRISPR-Cas approaches can be used for targeted modification of Synechococcus genes?

CRISPR-Cas systems have emerged as effective and versatile tools for genetic modification in Synechococcus species, with several approaches showing promise:

Genome Editing and Strain Improvement:
Researchers have successfully used targeted genome editing combined with enrichment outgrowth techniques to create enhanced strains of Synechococcus elongatus. For example, Wendt et al. created a new strain of Synechococcus elongatus 2973-T that was both naturally transformable and fast-growing .

Metabolic Engineering Applications:
CRISPR-Cas tools have been demonstrated effective for metabolic engineering of Synechococcus, allowing for precise modifications to metabolic pathways to enhance production of desired compounds or introduce new pathways .

Implementation Considerations:
When designing CRISPR-Cas strategies for Synechococcus, researchers should consider:

  • Selection of appropriate promoters for guide RNA expression

  • Codon optimization for Cas protein expression

  • Delivery methods appropriate for cyanobacterial cells

  • Screening methods to identify successful transformants

The CRISPR-Cas system could be particularly valuable for generating improved strains of Synechococcus for recombinant protein production, including modifications to the cytochrome b6f complex or related electron transport components .

How can the copper-responsive regulation system be leveraged for controlled expression of recombinant proteins?

Synechococcus and other cyanobacteria possess a sophisticated copper-responsive regulation system that controls the expression of electron carriers in the photosynthetic electron transport chain. This system can potentially be leveraged for controlled expression of recombinant proteins:

Molecular Components of the Regulation System:
The copper-responsive regulation system consists of:

  • PetR: A BlaI/CopY-family transcription factor that represses petE (plastocyanin) expression and activates petJ (cytochrome c6) in the absence of copper.

  • PetP: A BlaR-membrane protease that controls PetR levels in vivo .

Mechanism of Action:

  • In copper-limited conditions, PetR is stable and activates petJ while repressing petE.

  • When copper is present, PetP degrades PetR, leading to derepression of petE and repression of petJ.

  • This degradation requires both PetP and copper in vivo .

Potential Applications for Recombinant Expression:
This system offers several advantages for recombinant protein expression:

  • Specificity: The PetRP system regulates only four genes (petE, petJ, slr0601, and slr0602), highlighting its specificity and minimizing off-target effects .

  • Inducibility: The system responds to copper at the transcriptional level, providing a simple induction mechanism.

  • Evolutionary conservation: The system is widespread in cyanobacteria, though notably absent in most strains of the Synechococcus/Prochlorococcus groups .

Implementation Strategy:
To leverage this system, researchers could:

  • Replace the target gene downstream of the petE or petJ promoter

  • Utilize copper concentration as an induction mechanism

  • Engineer the PetR binding sites for modified expression characteristics

What are the most effective protocols for extracting and verifying recombinant proteins from Synechococcus transformants?

Effective extraction and verification of recombinant proteins from Synechococcus transformants involves several key methodological steps:

Protein Extraction Methods:
For cytoplasmic or periplasmic recombinant proteins, researchers have successfully used approaches that generate soluble protein fractions. Evidence from transformants expressing recombinant proteins (such as L TorA-EcaA Syn, L Cya-EcaA Cya, and L TorA-EcaA Cya) demonstrates that these proteins can be clearly detected in the soluble protein fraction of Synechococcus .

Verification Approaches:

  • Western Blotting:

    • Particularly effective when antibodies against the recombinant protein or an affinity tag are available

    • Can detect both the presence and approximate size of the recombinant protein

  • Enzymatic Activity Assays:

    • For recombinant enzymes, activity assays provide functional verification

    • Example: β-glucosidase activity is measurably higher in transgenic strains compared to wild type

    • In one study, β-glucosidase activity was 1.70-fold higher in the transgenic strain compared to wild type within the first 6 hours of incubation, increasing to 7.4 times after 18 hours

  • Time-Course Analysis:

    • Monitoring protein expression over time following induction provides insights into expression kinetics

    • Helps determine optimal harvest times for maximum protein yield

Considerations for Specific Compartments:
The localization of recombinant proteins affects extraction approaches:

  • Cytoplasmic proteins: General cell lysis followed by centrifugation

  • Periplasmic proteins: Osmotic shock methods

  • Membrane-associated proteins (like cytochrome b6): Detergent-based extraction methods

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.