Recombinant Synechococcus sp. Cytochrome c biogenesis protein CcsB (ccsB)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant CcsB is produced using genetic engineering techniques, where the gene encoding CcsB from Synechococcus sp. is expressed in a host organism like Escherichia coli . The recombinant protein is often fused with a tag, such as a histidine tag (His-tag), to simplify purification .

Key Characteristics of Recombinant Synechococcus sp. CcsB:

  • Source: Typically expressed in E. coli

  • Tag: Often includes an N-terminal His-tag for purification

  • Length: Full-length protein usually spans 1-430 amino acids

  • Purity: Generally greater than 90% as determined by SDS-PAGE

  • Storage: Recommended storage at -20°C to -80°C, avoiding repeated freeze-thaw cycles

  • Synonyms: ccsB, ccs1, SynWH7803_2031

  • UniProt ID: A5GNE2

Function and Mechanism

CcsB, along with CcsA, forms a membrane complex that plays a crucial role in heme delivery and the ligation of heme to cytochrome c in the periplasm . The CcsBA complex is part of the system II pathway for c-type cytochrome biogenesis, essential for bacteria like Bordetella pertussis .

The biogenesis of c-type cytochromes involves several steps:

  1. Heme Uptake and Delivery: CcsB and CcsA facilitate the transport of heme across the bacterial inner membrane .

  2. Apocytochrome Binding: The complex interacts with apocytochromes, which are cytochrome proteins without the heme cofactor .

  3. Heme Ligation: CcsB and CcsA catalyze the covalent attachment of heme to the apocytochrome, forming the functional c-type cytochrome .

Applications in Research

Recombinant CcsB is a valuable tool in various research areas:

  • Biocompatibility Studies: Synechococcus sp. PCC 7002, which contains CcsB, has been investigated for its biocompatibility with human dermal cells, showing potential in biomedical applications .

  • Cytochrome Biogenesis Research: Recombinant CcsB is utilized to study the mechanisms and capabilities of cytochrome c biogenesis systems .

  • Biotechnology: Cyanobacteria like Synechococcus sp. are of interest as "green gold" with potential applications in various biotechnological and biomedical contexts .

Biocompatibility with Human Dermal Cells

A study investigated the adaptability and biocompatibility of Synechococcus sp. PCC 7002 with human dermal cells. The cyanobacteria exhibited exponential growth under human cell culture conditions, and light exposure significantly impacted their growth. The study found no significant adverse effects on human cell viability and growth under coculture conditions .

Table 1: Metabolic Activity and Cytotoxicity Assessment of 3T3 Fibroblasts Cocultured with Synechococcus sp. PCC 7002

AssayConditionResult
AlamarBlue Assay3T3 fibroblasts with 5-fold higher bacteria1.5-fold higher fluorescence signal compared to a 1:1 bacterial ratio
AlamarBlue Assay3T3 culture with cell-specific DMEM2.5-fold higher metabolic activity compared to control with 1:1 diluted DMEM
LDH AssayBacteria’s A-D7 medium on 3T3 fibroblastsNo significant differences in lactate dehydrogenase activity between media
Cell Count (Day 2)3T3 fibroblasts with bacterial medium52.55 ± 41.79 × 10^6 cells/mL
Cell Count (Day 2)Fibroblasts without bacterial medium11.43 ± 20.71 × 10^6 cells/mL
Cell Count (Day 4)3T3 fibroblasts with bacterial medium74.26 ± 20.56 × 10^6 cells/mL
Cell Count (Day 4)Fibroblasts without bacterial medium134.96 ± 41.49 × 10^6 cells/mL

Biocompatibility with HaCaT Keratinocytes

The biocompatibility of Synechococcus sp. PCC 7002 with HaCaT keratinocytes was also assessed. The study measured metabolic activity using the AlamarBlue assay .

Table 2: Metabolic Activity of HaCaT Keratinocytes Cocultured with Synechococcus sp. PCC 7002

ConditionDayFluorescence Intensity
HaCaT alone26045 ± 92
HaCaT with cyanobacteria24360.33 ± 297
HaCaT alone45831.66 ± 545.08
HaCaT with cyanobacteria45670.33 ± 415.70

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ccsB; ccs1; SynWH7803_2031; Cytochrome c biogenesis protein CcsB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-430
Protein Length
full length protein
Species
Synechococcus sp. (strain WH7803)
Target Names
ccsB
Target Protein Sequence
MRTLNRVFAILSDLRLAIALLLLIAAASAVGTILPQQEAPELYLERFNADPWLGLINGDQ MLAFQLDHLYSSVWFLALLAWLGLALMLCSWRRQWPALQAAMRWIDYTRPRQLSKLALAE TLSCASSDGALSSLAIELKSRGWQVKQHQDRLAARRGVVGRVGPLLVHTGLVLLLIGAAW GALAGQRLERFLAPGRSLDLLDPAGANRLSLTLENFSITRDPAGRAEQFQSTLTLSPPGQ EDERRTISVNHPLRYQGMTVYQADWSLAAVTVQIGKSPMLQLPLSTFPELGDQVWGLVLP TRPDGSEPVFLSTSSEQGPVQVFGSDGALITNLRPGGEGTEVRGLPLKVIDILPASGLLL KRDPGVPLVYAGFAITLLGGALSMVATRQIWVISDAVHQRLHIGGLCNRNLLGFAAELPE LINRVDVSHG
Uniprot No.

Target Background

Function
Essential for the biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f), specifically during heme attachment.
Database Links
Protein Families
Ccs1/CcsB family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the CcsB protein in Synechococcus sp. and how does it compare across strains?

CcsB is a key integral membrane protein involved in cytochrome c biogenesis in Synechococcus sp. This protein functions as part of the System II cytochrome c maturation pathway. In most bacterial and plant genomes, CcsB and CcsA are encoded as individual genes, though in some organisms like Helicobacter hepaticus, they naturally fuse into a single CcsBA protein .

When examining Synechococcus strains, notable genomic variation exists that may influence CcsB expression and function. Genome sizes range from 2.11 to 3.86 Mb with G+C content varying between 40.6% (PCC 7502) to 68% (RSCF101). Freshwater isolates (≈3.1 Mb, 50.25% GC) generally have larger genomes with lower GC content compared to marine isolates (≈2.63 Mb, 57.57% GC) . These genomic differences may influence protein expression strategies when working with CcsB from different Synechococcus sources.

What is the structural organization of the CcsB/CcsBA complex?

The CcsBA complex (representing a natural fusion of CcsB and CcsA) contains 10 transmembrane domains (TMDs) that associate in the membrane to form a channel for heme translocation . Within this structure:

  • Two conserved histidines in TMDs (His-77 in TMD3 and His-858 in TMD8) form a low-affinity heme binding site within the membrane

  • Two external histidines (His-761 and His-897) flank the WWD domain, forming the "external heme binding domain"

  • These external histidines serve as axial ligands to the heme iron, protecting it from oxidation

  • The WWD domain appears to orient the heme, positioning the vinyl groups for interaction with the apocytochrome c CXXCH motif

While the above structure represents CcsBA from H. hepaticus, the fundamental organization is likely conserved in Synechococcus CcsB, although specific amino acid positions would differ.

What expression systems are most effective for recombinant Synechococcus sp. CcsB?

For membrane proteins like CcsB, the expression system selection is critical. Based on successful approaches with similar proteins:

  • E. coli-based expression systems:

    • BL21(DE3) with pET-based vectors has been successfully used for CcsBA, suggesting similar approaches may work for CcsB

    • Codon optimization may be necessary, especially considering the variation in GC content between Synechococcus strains (from 40.6% to 68%)

    • Addition of a C-terminal histidine tag facilitates purification while minimizing impact on function

  • Considerations for membrane protein expression:

    • Lower induction temperatures (16-20°C) to reduce aggregation

    • Use of specialized E. coli strains (like C41/C43) designed for membrane protein expression

    • Inclusion of chaperones may improve folding

For functional verification, reconstitution in E. coli strains lacking endogenous cytochrome c maturation systems can demonstrate whether the recombinant CcsB protein facilitates cytochrome c synthesis .

What purification strategy yields the highest quality recombinant CcsB protein?

A methodical purification approach for CcsB should include:

  • Membrane preparation:

    • Cell lysis by French press or sonication

    • Differential centrifugation to isolate membrane fractions

    • Solubilization using mild detergents (DDM or LMNG at 1-2%)

  • Chromatography sequence:

    • Immobilized metal affinity chromatography (IMAC) using histidine tag

    • Size exclusion chromatography for further purification and detergent exchange

    • Optional ion exchange chromatography for removal of contaminants

  • Quality assessment:

    • SDS-PAGE analysis to confirm purity

    • UV-visible spectroscopy to assess heme content

    • Circular dichroism to evaluate secondary structure

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to verify homogeneity

For functional studies, maintaining protein in reduced (Fe²⁺) state is critical, as oxidation significantly alters the protein's properties .

How can researchers accurately assess heme binding and transport activity of recombinant CcsB?

Assessment of CcsB heme binding and transport requires multiple complementary approaches:

  • Spectroscopic analysis:

    • UV-visible spectroscopy to detect characteristic heme absorption peaks

    • Pyridine hemochrome assay to quantify heme content

    • Reduced minus oxidized difference spectra to confirm heme redox properties

  • Heme trafficking assays:

    • Site-directed mutagenesis of key histidine residues (corresponding to H77, H858, H761, and H897 in CcsBA) and assessment of heme binding

    • Imidazole supplementation assays, which can rescue function in TMD histidine mutants by mimicking the histidine side chain

    • Fluorescent heme analogs to track movement through the protein

  • Reconstitution system:

    • Complementation of cytochrome c maturation-deficient E. coli strains

    • In vitro reconstitution using purified components (apocytochrome c, heme, and CcsB)

    • Proteoliposome-based heme transport assays to measure vectorial transport

The role of the histidines in CcsB/CcsBA in heme protection is particularly significant - mutations in the external histidines lead to oxidation of the heme iron from Fe²⁺ to Fe³⁺, indicating their critical role in maintaining the reduced state necessary for cytochrome c assembly .

What approaches can reveal the interaction between CcsB and apocytochrome c?

To characterize CcsB-apocytochrome interactions:

  • Biochemical approaches:

    • Pull-down assays using tagged proteins

    • Cross-linking followed by mass spectrometry

    • Surface plasmon resonance to determine binding kinetics

  • Structural studies:

    • Hydrogen-deuterium exchange mass spectrometry to map interaction surfaces

    • Cryo-electron microscopy to visualize complexes

    • Site-directed mutagenesis of the WWD domain and periplasmic regions

  • Functional assays:

    • In vitro cytochrome c synthesis monitoring formation of thioether bonds

    • Analysis of apocytochrome c variants with altered CXXCH motifs

Research suggests the WWD domain in CcsBA positions heme vinyl groups close to the reduced thiols of the apocytochrome c CXXCH motif, facilitating thioether bond formation . Detailed characterization of this interaction could reveal the molecular mechanism of cytochrome c assembly.

How do environmental factors influence CcsB function in different Synechococcus ecological contexts?

Given the diverse habitats of Synechococcus strains, environmental factors likely influence CcsB function:

Environmental FactorPotential Impact on CcsBResearch Approach
SalinityAltered membrane composition may affect CcsB stabilityCompare freshwater vs. marine Synechococcus CcsB in different ionic strengths
Light intensityChanges in photosynthetic electron transport demandAnalyze CcsB expression under different light regimes
Nutrient availabilityAltered cytochrome requirementsExamine CcsB activity in nutrient-limited conditions
TemperatureMembrane fluidity changes affecting protein dynamicsThermal stability assays of CcsB from strains adapted to different temperatures

Synechococcus strains from freshwater sources typically have larger genomes (≈3.1 Mb) compared to marine isolates (≈2.63 Mb) , which may reflect adaptations to different environmental pressures and could influence cytochrome c maturation pathways.

What is the current model for the mechanism of heme translocation by CcsB/CcsBA?

Based on research with CcsBA, the current mechanistic model for cytochrome c biogenesis involves:

  • Heme acquisition and transport:

    • Reduced heme (Fe²⁺) from the cytoplasm binds to a low-affinity site formed by His-77 (TMD3) and His-858 (TMD8)

    • Heme translocates through a channel formed by the TMDs to the external heme binding domain

    • At the external site, His-761 and His-897 ligate and protect the heme iron from oxidation

  • Cytochrome c assembly:

    • The WWD domain positions the heme vinyl groups near the reduced thiols of the apocytochrome c CXXCH motif

    • Spontaneous thioether bond formation occurs

    • Ligand switching takes place, with the histidine of the CXXCH motif replacing one of the external histidines as the fifth axial heme ligand

    • The sixth axial ligand forms upon folding of the cytochrome into its mature form

It remains unclear whether heme translocation is driven solely by concentration gradient (passive) or involves active transport mechanisms.

How does the System II cytochrome c maturation pathway in Synechococcus compare with other bacterial systems?

System II cytochrome c maturation in Synechococcus belongs to a broader pathway found in many bacteria and plant chloroplasts:

  • System I (Ccm): Found in many Gram-negative bacteria and plant mitochondria

  • System II (Ccs): Present in Gram-positive bacteria, cyanobacteria, and chloroplasts

  • System III (CCHL): Present in mitochondria of fungi, metazoans, and some protists

Specific features of System II in Synechococcus include:

  • The presence of CcsB and CcsA as separate proteins, unlike some organisms (e.g., H. hepaticus) where they fuse as CcsBA

  • Potential interaction with photosynthetic electron transport chain components

  • Likely specialized adaptations to freshwater or marine environments depending on the strain

Comparative genomic analysis of Synechococcus strains reveals significant variation in genome size (2.11-3.86 Mb) and GC content (40.6-68%) , suggesting possible diversification of cytochrome c maturation pathways across different ecological niches.

What are common pitfalls in recombinant CcsB expression and how can they be addressed?

Common challenges in CcsB expression and solutions include:

  • Protein misfolding and aggregation:

    • Solution: Lower induction temperature (16-20°C)

    • Use specialized E. coli strains (C41/C43)

    • Consider fusion tags that enhance solubility (MBP, SUMO)

    • Optimize detergent selection for membrane extraction

  • Low expression levels:

    • Solution: Codon optimization based on host system

    • Test different promoter strengths

    • Analyze GC content of Synechococcus strain (40.6-68%) to inform optimization

    • Consider synthetic gene design with optimized sequences

  • Loss of heme during purification:

    • Solution: Add heme precursors to growth media

    • Maintain reducing conditions throughout purification

    • Include imidazole when purifying certain histidine mutants

    • Use spectroscopic methods to monitor heme status

  • Improper membrane insertion:

    • Solution: Add N-terminal signal sequences appropriate for host

    • Use membrane fraction isolation techniques to verify localization

    • Employ protease accessibility assays to confirm topology

How can researchers differentiate between CcsB and CcsBA functions in experimental systems?

To distinguish CcsB and CcsBA functions:

  • Complementation studies:

    • Express CcsB alone, CcsA alone, or both together in cytochrome c maturation-deficient systems

    • Compare with naturally fused CcsBA proteins

    • Create artificial fusions with flexible linkers between CcsB and CcsA

  • Domain analysis:

    • Generate chimeric constructs swapping domains between CcsB and CcsBA

    • Use progressive truncation to identify minimal functional units

    • Perform co-immunoprecipitation to verify interaction between separate CcsB and CcsA proteins

  • Structural comparisons:

    • Analyze transmembrane topology using reporter fusions

    • Compare heme binding sites and histidine conservation

    • Examine differences in WWD domain accessibility and function

Understanding the relationship between separate CcsB and CcsA versus fused CcsBA provides insights into the evolution of cytochrome c maturation systems across bacterial species.

What emerging technologies could advance our understanding of CcsB structure and function?

Several cutting-edge approaches hold promise for CcsB research:

  • Structural biology advances:

    • Cryo-electron microscopy for membrane protein structures without crystallization

    • Integrative structural biology combining multiple data sources

    • Microcrystal electron diffraction for small membrane protein crystals

  • Dynamic studies:

    • Time-resolved spectroscopy to capture heme transport intermediates

    • Single-molecule FRET to monitor conformational changes

    • Molecular dynamics simulations based on structural models

  • Systems biology approaches:

    • Multi-omics integration to understand CcsB regulation in context

    • Synthetic biology to create minimal cytochrome c biogenesis systems

    • Metabolic flux analysis to quantify impact on electron transport

  • Genomic approaches:

    • Comparative genomics across the diverse Synechococcus strains (with genome sizes ranging from 2.11 to 3.86 Mb)

    • Analysis of co-evolution patterns between CcsB and cytochromes

    • Metagenomics to identify novel CcsB variants in uncultured Synechococcus populations

How might understanding CcsB function contribute to synthetic biology applications?

Knowledge of CcsB mechanisms could enable:

  • Engineered electron transport chains:

    • Design of synthetic cytochrome c variants with altered properties

    • Creation of artificial redox modules for biotechnology

    • Optimization of electron flow in engineered photosynthetic systems

  • Bioenergy applications:

    • Enhanced bioelectrochemical systems using engineered cytochromes

    • Improved photobiological hydrogen production

    • Optimization of electron transfer to electrodes

  • Biosensing platforms:

    • Heme-based biosensors for environmental monitoring

    • Redox-sensitive cellular reporters

    • Electrochemical detection systems based on cytochrome c interactions

Understanding the precise mechanism by which CcsB/CcsBA facilitates cytochrome c maturation could lead to novel approaches for engineering electron transport chains in both natural and synthetic biological systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.