Recombinant Synechococcus sp. Glycerol-3-phosphate acyltransferase (plsY)

Shipped with Ice Packs
In Stock

Description

Functional Role in Lipid Metabolism

PlsY initiates phospholipid biosynthesis by acylating G3P at the sn-1 position. Key mechanistic insights include:

  • Substrate Specificity: Prefers C16:0 (palmitate)-acyl donors over C18:0, as shown in Synechocystis sp. PCC 6803 homologs .

  • Cooperation with PlsX and PlsC:

    • PlsX converts acyl-ACP to acyl-phosphate .

    • PlsY transfers the acyl group to G3P .

    • PlsC (1-acyl-G3P acyltransferase) completes PtdOH synthesis .

Overexpression of plsX-plsY-plsC in Synechocystis sp. PCC 6803 increased lipid production by 2.3-fold, highlighting its metabolic engineering potential .

Enhanced Lipid Production

Studies demonstrate that recombinant PlsY overexpression redirects carbon flux toward phospholipid synthesis. For example:

StrainGenetic ModificationLipid IncreaseReference
Synechocystis Δsll1848plsY overexpression130% higher C16:0
Synechocystis OAGRplsY + glpD + rbcLXS3.1x total lipids

Biotechnological Relevance

  • Biofuel Feedstock: Engineered cyanobacteria with upregulated plsY show promise for sustainable lipid-derived biofuel production .

  • Stress Adaptation: PlsY-linked lipid remodeling aids cyanobacterial tolerance to sulfane sulfur stress, as observed in Synechococcus sp. PCC7002 .

Discussion and Future Directions

Recombinant PlsY serves as a pivotal tool for dissecting lipid biosynthesis mechanisms and engineering high-lipid cyanobacterial strains. Challenges remain in optimizing its activity in heterologous hosts and scaling production for industrial use. Future studies may explore:

  • Crystallography: Resolving its 3D structure to guide enzyme engineering .

  • Synthetic Biology: Integrating plsY into modular pathways for carbon-neutral biomanufacturing .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please specify your preference in the order notes and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance for additional fees.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses and avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its inclusion in the development process.
Synonyms
plsY; CYA_1269; Glycerol-3-phosphate acyltransferase; Acyl-PO4 G3P acyltransferase; Acyl-phosphate--glycerol-3-phosphate acyltransferase; G3P acyltransferase; GPAT; Lysophosphatidic acid synthase; LPA synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime)
Target Names
plsY
Target Protein Sequence
MPAWLSALLAALGGYLLGSIPTGYWVGRCWGGIDLRQAGSGSTGATNVLRTVGKGPALLV LLVDAAKGAAAVALGSALGSPWWVVVAALGAVIGHSRSCWLGFKGGKSVATSLGILLAMA WPVALATFGVWLLGIALTRIVSFSSLLAAVAAPLLMWALGQPLPYLLFALAGGVYVIAAH RRNIERLLAGSEPRIGQKWAQSP
Uniprot No.

Target Background

Function
Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phosphate as the fatty acyl donor, but not acyl-CoA or acyl-ACP.
Database Links
Protein Families
PlsY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Glycerol-3-phosphate acyltransferase (plsY) in Synechococcus sp.?

Glycerol-3-phosphate acyltransferase (plsY) is an integral membrane protein that plays a crucial role in bacterial membrane phospholipid biosynthesis. It catalyzes the transfer of an acyl group from acylphosphate to glycerol-3-phosphate, forming lysophosphatidic acid, which is a key intermediate in phospholipid synthesis. PlsY specifically functions in the most widely distributed biosynthetic pathway that initiates phosphatidic acid formation in bacterial membrane phospholipid biosynthesis . The process involves the conversion of acyl-acyl carrier protein to acylphosphate by PlsX, followed by the transfer of the acyl group from acylphosphate to glycerol-3-phosphate by PlsY .

In cyanobacteria like Synechococcus sp., this enzyme is particularly important for lipid metabolism and membrane formation. The gene encoding plsY in Synechococcus elongatus has been identified and characterized, with the protein being named "Acyl-PO4 G3P acyltransferase" or "Acyl-phosphate-glycerol-3-phosphate acyltransferase" .

What are the optimal expression systems for recombinant Synechococcus sp. plsY?

For expression of recombinant Synechococcus sp. plsY, two primary systems have been documented in the literature:

  • Escherichia coli expression system: The search results indicate that plsY from Synechococcus elongatus can be successfully expressed in vitro using E. coli expression systems . This approach is often preferred for initial characterization studies due to the high yields and established protocols for E. coli cultivation.

  • Native Synechococcus expression: For studies requiring more native-like post-translational modifications or functional analyses, expression in Synechococcus itself offers advantages. Transformation of Synechococcus elongatus PCC 7942 relies on homologous recombination between the cell's chromosome and exogenous DNA containing sequences homologous to the chromosome .

For expression in Synechococcus, vectors like pSyn_1 have been designed specifically for integration into neutral sites in the Synechococcus elongatus genome. These vectors contain:

  • Neutral Site 1 (NS1) homologous recombination sites for genomic integration

  • A promoter (such as the weak constitutive promoter of solanesyl diphosphate synthase gene)

  • A spectinomycin resistance gene for selection

  • A multiple cloning site for inserting the gene of interest

How can successful transformation of Synechococcus with recombinant plsY be verified?

Verification of successful transformation and expression of recombinant plsY in Synechococcus can be performed using the following methods:

  • Colony PCR screening: This method can confirm the presence and correct integration of the plsY gene into the Synechococcus genome.

Protocol:

  • Pick colonies and resuspend them in PCR SuperMix High Fidelity containing appropriate primers

  • Incubate the reaction for 10 minutes at 94°C to lyse cells

  • Amplify for 20-30 cycles using standard PCR protocols

  • Visualize by agarose gel electrophoresis to confirm the presence of the correct insert

  • Full integration verification: To ensure complete integration of the promoter and gene of interest, additional colony PCR can be performed using primers that span the integration site.

  • Sequence verification: For final confirmation, PCR products can be sequenced to verify the correct sequence of the integrated plsY gene .

What are the key functional motifs in plsY and how do they impact enzyme activity?

Research on bacterial plsY proteins has identified three conserved motifs that are critical for plsY catalysis:

Motif 1: Contains essential serine and arginine residues that are critical for catalytic activity.

Motif 2: Has characteristics of a phosphate-binding loop and corresponds to the glycerol-3-phosphate binding site. Site-directed mutagenesis experiments have shown that mutations of conserved glycines in this motif to alanines result in a Km defect for glycerol-3-phosphate binding .

Motif 3: Contains a conserved histidine and asparagine that are important for activity, as well as a glutamate that is critical to the structural integrity of the enzyme .

These motifs are located in the three larger cytoplasmic domains of the protein, which aligns with their role in substrate binding and catalysis.

How does membrane topology affect plsY function?

PlsY is an integral membrane protein with a specific topology that is essential for its function. Studies using the substituted cysteine accessibility method have determined that plsY has:

  • Five membrane-spanning segments

  • The amino terminus positioned on the external face of the membrane

  • Two short loops also located on the external face

  • Three larger cytoplasmic domains containing the conserved catalytic motifs

This topology positions the catalytic domains on the cytoplasmic side of the membrane, where they can access both the acylphosphate substrate (produced by PlsX) and glycerol-3-phosphate, allowing for the synthesis of lysophosphatidic acid which is retained in the membrane.

How can recombinant plsY be used to study bacterial lipid metabolism?

Recombinant plsY offers several approaches for studying bacterial lipid metabolism:

  • In vitro enzyme kinetics: Purified recombinant plsY can be used to study enzyme kinetics, substrate specificity, and inhibitor sensitivity. Research has shown that plsY is noncompetitively inhibited by palmitoyl-CoA, suggesting complex regulatory mechanisms in lipid metabolism .

  • Mutagenesis studies: Site-directed mutagenesis of conserved residues can help elucidate the catalytic mechanism and identify key amino acids involved in substrate binding and catalysis. Previous studies have demonstrated the importance of specific residues in each of the three conserved motifs .

  • Heterologous expression: Expression of Synechococcus plsY in other organisms can be used to complement mutant phenotypes or to enhance lipid production for biotechnological applications.

  • Systems biology approaches: Integration of plsY function into broader lipid metabolism networks can help understand regulatory mechanisms controlling membrane phospholipid synthesis in cyanobacteria.

What methods are available for measuring plsY activity in vitro?

For in vitro assessment of plsY activity, researchers can employ several approaches:

  • Acyltransferase activity assay: Measuring the transfer of acyl groups from acylphosphate to glycerol-3-phosphate by monitoring the formation of lysophosphatidic acid. This can be done using radiolabeled substrates or through coupled enzyme assays.

  • HPLC or mass spectrometry: These techniques can be used to quantify the products of the plsY reaction, providing sensitive and specific measurement of enzyme activity.

  • Fluorescence-based assays: Development of fluorescent reporters linked to plsY activity can provide real-time monitoring of enzyme function.

What are common challenges in expressing recombinant plsY and how can they be addressed?

Expressing recombinant membrane proteins like plsY presents several challenges that researchers should anticipate:

  • Low expression levels: As an integral membrane protein, plsY may express at lower levels than soluble proteins.

    • Solution: Optimize codon usage for the expression host, use strong inducible promoters, and test different growth conditions to maximize expression.

  • Protein misfolding: Improper folding can lead to inactive protein or aggregation.

    • Solution: Express at lower temperatures (16-25°C), use specialized E. coli strains designed for membrane protein expression, or consider expression in a more native-like environment such as Synechococcus itself.

  • Toxicity to host cells: Overexpression of membrane proteins can disrupt host cell membranes.

    • Solution: Use tightly regulated inducible expression systems and monitor cell growth carefully after induction.

  • Protein degradation: Recombinant proteins may be susceptible to proteolytic degradation.

    • Solution: Include protease inhibitors during purification, use protease-deficient host strains, or add fusion tags that enhance stability.

How can the stability of purified plsY be maintained?

Maintaining the stability of purified plsY requires careful attention to storage conditions:

  • Buffer optimization: The search results indicate that purified recombinant Synechococcus plsY is typically stored in Tris-based buffer with 50% glycerol .

  • Temperature considerations: Store at -20°C for short-term storage, or at -80°C for extended storage. Working aliquots can be maintained at 4°C for up to one week .

  • Freeze-thaw cycles: Repeated freezing and thawing is not recommended as it can lead to protein denaturation and activity loss .

  • Additives: Consider adding stabilizing agents such as glycerol (typically 50%) to prevent protein denaturation during freezing .

How does Synechococcus plsY compare to plsY from other bacterial species?

While the search results don't provide specific comparisons between Synechococcus plsY and plsY from other species, general observations about plsY conservation and variability can be made:

  • Conserved catalytic motifs: The three key motifs identified in bacterial plsY proteins are likely conserved in Synechococcus plsY, as they are essential for catalytic function.

  • Membrane topology: The five membrane-spanning segments and the positioning of catalytic domains are likely similar across bacterial species, reflecting the conserved function of this enzyme.

  • Species-specific adaptations: Differences in amino acid sequence outside the conserved motifs may reflect adaptations to the specific membrane environments of different bacterial species. Synechococcus, as a photosynthetic cyanobacterium, may have adaptations related to thylakoid membrane formation that are not present in non-photosynthetic bacteria.

A detailed comparative analysis of plsY sequences from multiple bacterial species could yield insights into evolutionary conservation and functional specialization of this important enzyme.

What are the implications of plsY function for cyanobacterial biotechnology?

Cyanobacteria like Synechococcus are increasingly being explored as platforms for biotechnology applications, and understanding plsY function has several implications for these efforts:

  • Lipid production engineering: As a key enzyme in phospholipid biosynthesis, modifying plsY activity could potentially alter membrane composition or enhance lipid production for biofuel applications.

  • Membrane engineering: Engineering cyanobacterial membranes through modifications of lipid biosynthesis enzymes like plsY could create strains with enhanced tolerance to environmental stresses or improved capacity for producing membrane-associated products.

  • Synthetic biology approaches: The GeneArt Synechococcus Engineering Kits allow for integration of genes into neutral sites in the Synechococcus genome, enabling precise genetic modifications for biotechnology applications .

Recent developments in cyanobacterial biotechnology have established Synechococcus sp. PCC 11901 as a promising strain for biotechnology applications, with tools for genetic manipulation that could be applied to studying and engineering plsY function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.