Recombinant Synechococcus sp. Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; CYA_2192; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-132
Protein Length
full length protein
Species
Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime)
Target Names
mscL
Target Protein Sequence
MRAFLEEFKKFISRGNALDLAVGVVIGGAFGKIVTSFVADLFTPVLGLMIGGVSFQNLVW KIGGSPEDPVTINYGSFLQAVFDFVIIAFAIFLLVKAINTLQRKEEESPPTLPPPEVVLL TEIRDILNRHSQ
Uniprot No.

Target Background

Function
A membrane channel that opens in response to mechanical stress (stretch) within the lipid bilayer. It may play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genetic identity of MscL in Synechococcus species?

Synechococcus species contain a single gene encoding a large-conductance mechanosensitive channel (MscL). In Synechococcus sp. strain PCC 6803, this gene is designated as symscL (slr0875). The gene encodes a protein that functions as part of the mechanosensitive machinery in the plasma membrane, responsible for the release of cytoplasmic solutes during osmotic stress responses . It's worth noting that SyMscL has been reported as one of the most divergent of the known MscL proteins, possessing a highly distinct hydrophilic carboxy terminus compared to other bacterial MscL homologs .

Where is MscL localized in Synechococcus cells?

The MscL protein (SyMscL) in Synechococcus is predominantly localized to the plasma membrane, as demonstrated by subcellular fractionation studies. Western blot analysis using antibodies specific for SyMscL has shown that the majority of the protein is detected in the plasma membrane fraction, which can be validated by the presence of plasma membrane markers such as the nitrate transporter NrtA . This localization is consistent with its physiological role in mediating responses to environmental osmotic changes by facilitating the release of cytoplasmic solutes when necessary .

What is the primary physiological role of MscL in Synechococcus?

The primary physiological role of MscL in Synechococcus appears to be adaptation to hypoosmotic stress. Studies with MscL-deficient mutants (Δsymscl) have demonstrated that these cells swell more rapidly than wild-type cells under hypoosmotic stress conditions, as measured by stopped-flow spectrophotometry . Additionally, the expression of symscL is under circadian control, with peak expression corresponding to the beginning of subjective night, suggesting that MscL functions as part of the osmotic homeostatic regulatory system that helps Synechococcus adapt to daily metabolic osmotic fluctuations and environmental changes .

How do researchers generate MscL knockout mutants in Synechococcus?

To generate MscL knockout mutants in Synechococcus, researchers typically use a gene disruption approach that involves insertion of an antibiotic resistance cassette into the symscL gene. The specific methodology includes:

  • Construction of a plasmid containing the symscL gene disrupted by an antibiotic resistance marker (e.g., spectinomycin resistance cassette)

  • Transformation of Synechococcus cells with this construct, exploiting the natural competence of strains like Synechococcus elongatus PCC 7942

  • Selection of transformants on media containing the appropriate antibiotic

  • Successive streaking to achieve homogeneous segregation of the mutation

  • Confirmation of gene disruption by PCR amplification and sequencing

This approach takes advantage of the robust homologous recombination machinery present in Synechococcus species .

How does the functional mechanism of Synechococcus MscL differ from E. coli MscL?

While both Synechococcus MscL (SyMscL) and Escherichia coli MscL (EcMscL) function as mechanosensitive channels, significant differences exist in their activation properties and pressure sensitivity:

ParameterSynechococcus MscLE. coli MscLNotes
Activation pressure~3x higher than EcMscS~1.5x higher than EcMscSSyMscL requires substantially higher pressure for activation
Structural featuresHighly distinct hydrophilic C-terminusMore conserved C-terminusSyMscL is more divergent among MscL homologs
Phenotypic impactDeletion causes clear osmotic vulnerabilityDeletion shows no apparent phenotypeSuggests different physiological importance
Secondary functionsCalcium release during temperature stressNot reportedSyMscL may have additional signaling roles

These differences suggest that SyMscL has evolved specific adaptations for survival in environments with more extreme hypoosmotic stress challenges . The higher pressure threshold for activation may represent an evolutionary adaptation that fine-tunes the channel's response to the specific environmental conditions faced by Synechococcus species.

What approaches can be used to study MscL channel gating and conductance in Synechococcus?

Studying MscL channel gating and conductance in Synechococcus requires specialized techniques that can detect channel opening in response to membrane tension. Key methodological approaches include:

  • Patch-clamp electrophysiology:

    • Giant spheroplast preparation from Synechococcus cells

    • Application of negative pressure to excised membrane patches

    • Recording of single-channel currents at different membrane potentials

    • Analysis of conductance (reported at approximately 3 nanosiemens for MscL channels)

  • Stopped-flow spectrophotometry:

    • Measurement of light scattering changes corresponding to cell volume adjustments

    • Preparation of cell suspensions with defined osmolarity (e.g., in BG11 medium with 1M sorbitol)

    • Rapid mixing with hypoosmotic solutions in a stopped-flow apparatus

    • Recording of 90° light scattering at 575 nm

    • Data fitting to exponential curves to determine time constants of volume changes

  • Fluorescent probes for solute efflux:

    • Loading cells with fluorescent reporter molecules

    • Monitoring efflux rates under osmotic downshock conditions

    • Comparing wild-type and MscL mutant strains

These approaches provide complementary data on channel function, allowing researchers to characterize the biophysical properties of SyMscL in its native context.

How can recombinant Synechococcus MscL be effectively expressed and purified for structural studies?

Expression and purification of recombinant Synechococcus MscL for structural studies requires careful optimization due to the challenges associated with membrane protein handling. A recommended protocol includes:

  • Expression system selection:

    • Heterologous expression in E. coli using specialized strains (C41, C43) designed for membrane proteins

    • Alternatively, homologous expression in Synechococcus elongatus PCC 7942 using the native psbA2 promoter, which responds to stress conditions

  • Construct design:

    • Fusion with affinity tags (His6, FLAG) for purification

    • Inclusion of cleavable linkers to remove tags after purification

    • Codon optimization if expressing in E. coli

  • Expression optimization:

    • For E. coli: Induction at lower temperatures (16-20°C) to facilitate proper folding

    • For Synechococcus: Consider magnetic field application (30 mT) which has been shown to enhance recombinant protein production under the psbA2 promoter

  • Membrane extraction and purification:

    • Cell disruption by sonication or French press

    • Membrane isolation by ultracentrifugation

    • Solubilization with mild detergents (DDM, LDAO)

    • Affinity chromatography followed by size exclusion chromatography

    • Detergent exchange or reconstitution into nanodiscs or liposomes for structural studies

  • Quality assessment:

    • SDS-PAGE and western blotting

    • Mass spectrometry

    • Circular dichroism to confirm secondary structure

    • Functional assays in liposomes

This methodological approach maximizes the likelihood of obtaining properly folded, functional MscL protein suitable for structural studies using X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy.

What strategies can improve functional recombinant MscL production in Synechococcus expression systems?

Several strategies can enhance the production of functional recombinant MscL in Synechococcus expression systems:

  • Promoter selection and optimization:

    • Utilize the psbA2 promoter, which responds to stress conditions and has been successfully used for recombinant protein expression in Synechococcus elongatus PCC 7942

    • Consider native promoters over exogenous ones to eliminate the need for costly inducers and reduce potential cell stress

  • Physical enhancement methods:

    • Application of magnetic fields, particularly at 30 mT (MF30), which has been shown to significantly increase recombinant protein expression under the psbA2 promoter

    • This approach impacts the cyanobacterial photosynthetic machinery through stress-induced shifts in gene expression and enzyme activity

    • MF30 treatment positively affects photosystem II (PSII) without disrupting the electron transport chain

  • Genetic optimization:

    • Integration of the gene into genomic neutral sites to ensure stable expression

    • Codon optimization based on Synechococcus codon usage preferences

    • Inclusion of appropriate translation initiation signals

  • Culture condition optimization:

    • Light intensity and spectral quality adjustments

    • Temperature modulation during expression phase

    • Carbon dioxide supplementation

    • Nutrient availability optimization

These approaches leverage the photoautotrophic nature of Synechococcus while addressing the specific challenges of membrane protein expression. The use of native stress-responsive promoters combined with physical enhancement methods like magnetic field application represents a particularly promising approach for increasing recombinant MscL yields .

What controls should be included when assessing MscL function in osmotic response experiments?

When designing experiments to assess MscL function in osmotic response, several essential controls should be included:

  • Isoosmotic controls:

    • Mix cell suspensions with media of identical osmolarity (e.g., BG11 containing 1M sorbitol when cells are equilibrated in the same medium)

    • This control confirms that observed responses are due to osmotic shifts rather than mechanical perturbation

  • Wild-type positive controls:

    • Include parallel experiments with wild-type Synechococcus strains

    • Provides baseline response for comparative analysis

  • Complementation controls:

    • Reintroduce the wild-type symscL gene into the knockout mutant

    • Confirms that observed phenotypes are specifically due to MscL deficiency rather than secondary mutations

  • Alternative MS channel controls:

    • Test mutants lacking other mechanosensitive channels (Synechocystis contains nine genes encoding putative MS channels)

    • Determines the relative contribution of MscL versus other MS channels

  • Osmotic gradient series:

    • Apply a range of osmotic downshock intensities

    • Establishes the threshold for MscL activation and dose-response relationships

  • Time course measurements:

    • Monitor responses at multiple time points

    • Captures the dynamics of adaptation rather than just endpoint measurements

Proper inclusion of these controls ensures robust interpretation of experimental data and helps distinguish MscL-specific effects from general osmotic responses or experimental artifacts.

How can researchers address challenges in detecting MscL expression in Synechococcus?

Detection of MscL expression in Synechococcus can be challenging due to potentially low abundance and the complexities of membrane protein analysis. Researchers can address these challenges through the following approaches:

  • Optimized protein extraction:

    • Use specialized protocols for membrane protein extraction

    • Include protease inhibitors to prevent degradation

    • Optimize detergent type and concentration for solubilization

  • Enhanced detection methods:

    • Generate high-specificity antibodies against SyMscL

    • Consider epitope tagging (His, FLAG, etc.) of recombinant MscL

    • Use sensitive detection systems (chemiluminescence, fluorescent secondary antibodies)

  • Subcellular fractionation:

    • Employ aqueous polymer two-phase partitioning followed by sucrose density gradient centrifugation to separate plasma membrane from thylakoid membrane fractions

    • Validate fractionation with established marker proteins (e.g., plasma membrane: NrtA; thylakoid: NdhD3 and NdhF3)

  • Transcript analysis alternatives:

    • Quantify mRNA levels using qRT-PCR when protein detection is difficult

    • Consider using reporter gene fusions (e.g., symscL promoter driving luciferase expression)

    • Track circadian expression patterns, noting that peak expression corresponds to the beginning of subjective night

  • Mass spectrometry approaches:

    • Use targeted proteomics with multiple reaction monitoring (MRM)

    • Apply enrichment strategies for membrane proteins prior to analysis

These methodological refinements can help overcome the technical challenges associated with detecting MscL expression in Synechococcus and provide more reliable quantitative data.

What methods are most effective for studying the circadian regulation of MscL expression?

To effectively study the circadian regulation of MscL expression in Synechococcus, researchers should employ a combination of the following methodologies:

  • Time-course sampling protocols:

    • Synchronize cultures using a 12:12 light-dark cycle for several days

    • Transfer to continuous light (LL) conditions to observe free-running rhythm

    • Collect samples at regular intervals (e.g., every 4 hours) for at least 48 hours

    • Maintain constant temperature and other environmental conditions

  • Expression monitoring techniques:

    • Quantitative RT-PCR to measure symscL transcript levels over time

    • Western blotting with anti-SyMscL antibodies for protein quantification

    • Luciferase reporter fusions to the symscL promoter for real-time monitoring

    • RNA-Seq for genome-wide expression context

  • Genetic manipulation approaches:

    • Analysis in clock gene mutants (e.g., kaiA, kaiB, kaiC deletion strains)

    • Promoter mutation studies to identify clock-controlled elements

    • Overexpression studies to assess effects on rhythm

  • Data analysis methods:

    • Fourier transform analysis to identify periodicity

    • Phase relationship analysis with known clock-controlled genes

    • Correlation with metabolic oscillations

  • Functional correlation:

    • Test osmotic shock response at different circadian phases

    • Measure MscL activity using electrophysiological techniques at different time points

    • Assess cell volume recovery kinetics throughout the circadian cycle

Since research has shown that symscL expression is under circadian control, with peak expression corresponding to the beginning of subjective night , these approaches will help elucidate the molecular mechanisms linking the circadian clock to osmotic homeostasis regulation in Synechococcus.

How should stopped-flow spectrophotometry data be interpreted to assess MscL function?

Interpreting stopped-flow spectrophotometry data for assessment of MscL function requires careful analysis of light scattering patterns that reflect cell volume changes. The following analytical approach is recommended:

  • Key parameters to extract and interpret:

    • Time constants (τ) of exponential fits to light scattering decreases

    • Substantially faster decreases (smaller τ values) in MscL mutants indicate compromised osmotic regulation

    • For example, wild-type Synechocystis exhibits τ = 21.06 ± 0.74 ms while Δsymscl mutants show τ = 8.69 ± 0.80 ms under identical hypoosmotic conditions

  • Secondary response features:

    • Analyze any increases in scattered light intensity following initial decreases

    • Such increases (seen in Δsymscl cells but not wild-type) may indicate cell bursting due to lack of MscL-mediated osmolyte efflux

  • Statistical analysis recommendations:

    • Perform at least three independent measurements per condition

    • Apply appropriate statistical tests (e.g., Student's t-test) to confirm significance of differences

    • Report mean values with standard deviation or standard error

  • Control data interpretation:

    • Confirm absence of volume changes in isoosmotic controls

    • Validate that observed responses are specific to osmotic transitions

  • Calibration considerations:

    • Consider establishing a calibration curve relating light scattering to cell volume

    • Use fixed cell samples of known volumes or osmolytes that cause defined volume changes

This analytical framework provides quantitative assessment of MscL contribution to osmotic regulation and allows for comparison between different genetic backgrounds or environmental conditions.

What are the key considerations when using Synechococcus as a model system for studying mechanosensitive channels?

When using Synechococcus as a model system for studying mechanosensitive channels, researchers should consider several important factors:

  • Strain selection considerations:

    • Synechococcus elongatus PCC 7942 is preferred due to its natural transformability, robust homologous recombination machinery, small genome, and ability to form distinct colonies

    • Consider that some lab strains may have lost natural competence over time

    • Verify the genetic stability of your chosen strain

  • Growth and experimental conditions:

    • Optimize light intensity, spectral quality, and photoperiod

    • Maintain consistent temperature (typically 29-30°C for optimal growth)

    • Use appropriate media (e.g., BG11) with consistent composition

    • Control CO2 availability for consistent photosynthetic activity

  • Genetic context awareness:

    • Recognize that Synechocystis contains nine genes encoding putative mechanosensitive channels

    • Consider potential functional redundancy and compensation mechanisms

    • Design experiments that can distinguish MscL-specific functions from other MS channels

  • Physiological distinctions:

    • Note that SyMscL requires approximately three times higher pressure for activation than E. coli MscS

    • Consider the potential dual role of SyMscL in both osmotic regulation and calcium signaling during temperature stress

    • Account for circadian regulation of MscL expression

  • Technical adaptations:

    • Adjust protocols developed for other bacterial systems to accommodate cyanobacterial cell architecture (presence of thylakoid membranes, cell wall characteristics)

    • Consider photoautotrophic metabolism when designing experimental protocols

By addressing these considerations, researchers can maximize the utility of Synechococcus as a model system for mechanosensitive channel research while accounting for its unique biological characteristics.

How does MscL function interact with other osmotic stress response mechanisms in Synechococcus?

The interaction between MscL function and other osmotic stress response mechanisms in Synechococcus represents a complex network of complementary systems:

  • Hierarchical activation of mechanosensitive channels:

    • While Synechocystis contains nine genes encoding putative mechanosensitive channels , they likely have different activation thresholds

    • MscL typically requires higher activation pressure than MscS-type channels, suggesting a sequential activation during increasing hypoosmotic stress

    • Consider potential compensatory upregulation of other MS channels in MscL mutants

  • Integration with compatible solute metabolism:

    • Analyze the relationship between MscL-mediated solute efflux and active accumulation/synthesis of compatible solutes during hyperosmotic stress

    • Investigate whether compatible solute profiles differ in MscL mutants

  • Coordination with ion transport systems:

    • MscL may have roles in calcium signaling during stress responses

    • Examine interactions with dedicated ion transporters that maintain ionic homeostasis

  • Temporal coordination through circadian regulation:

    • MscL expression follows circadian patterns with peak expression at the beginning of subjective night

    • This suggests coordination with daily fluctuations in cellular metabolism and environmental conditions

    • Investigate whether other osmotic stress response mechanisms show complementary circadian patterns

  • Photosynthetic apparatus protection:

    • Consider how MscL function helps maintain photosynthetic integrity during osmotic fluctuations

    • Examine potential co-regulation with systems that protect thylakoid membrane structure

Understanding these interactions provides insight into how Synechococcus integrates multiple mechanisms to maintain osmotic homeostasis across varying environmental conditions. The circadian regulation of MscL suggests it functions as part of a coordinated anticipatory response to predictable daily osmotic challenges rather than merely as an emergency release valve.

What are the current challenges and future directions in studying recombinant Synechococcus MscL?

Current challenges and promising future directions in studying recombinant Synechococcus MscL include:

  • Structural characterization challenges:

    • Limited high-resolution structural data specific to SyMscL

    • Difficulties in crystallizing membrane proteins or preparing them for cryo-EM

    • Future opportunities for structural studies using advanced approaches like lipid cubic phase crystallization or nanodiscs for cryo-EM

  • Functional assessment limitations:

    • Technical challenges in direct electrophysiological recording from cyanobacterial membranes

    • Need for improved heterologous expression systems that maintain native channel properties

    • Development of high-throughput functional assays for mechanosensitive channel activity

  • Regulatory network gaps:

    • Incomplete understanding of circadian control mechanisms for MscL expression

    • Limited knowledge of potential post-translational modifications affecting channel function

    • Need for systems biology approaches to map the complete regulatory network

  • Biotechnological applications:

    • Exploring the potential of engineered MscL variants as controlled release valves in synthetic biology applications

    • Utilizing native promoters like psbA2 combined with physical enhancement methods like magnetic field application (30 mT) to optimize recombinant protein production

    • Developing Synechococcus as a sustainable biofactory leveraging its photoautotrophic metabolism and CO2 utilization capacity

  • Comparative biology opportunities:

    • Expanded studies comparing MscL function across different cyanobacterial species and ecotypes

    • Investigation of evolutionary adaptations in MscL properties related to habitat preferences

    • Correlation of MscL sequence diversity with functional properties and ecological niches

Addressing these challenges will require interdisciplinary approaches combining structural biology, electrophysiology, molecular genetics, systems biology, and synthetic biology. The unique properties of Synechococcus MscL, including its distinct C-terminus, higher activation threshold, and circadian regulation , make it a particularly interesting subject for comparative mechanobiology studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.