Recombinant Synechococcus sp. Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lspA; SYNW1079; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Synechococcus sp. (strain WH8102)
Target Names
lspA
Target Protein Sequence
MTGSILRRAPLLGVAGLVVLVDQATKLLAASQLADGRIVQLLPGLINGQLVHNTGAAFSL FRGSVQWLGLLSLAVTTGLLIWVVRHRTPPFWQGMAVAFLLGGTLGNGIDRWRLGHVIDF LALVPINFPIFNPADIAINLAVLCFLVDLWSSRTSSRHG
Uniprot No.

Target Background

Function

This protein is a specific catalyst for the removal of signal peptides from prolipoproteins.

Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of lipoprotein signal peptidase (LspA) in Synechococcus sp.?

LspA (also known as Signal Peptidase II or SPase II) is a membrane-bound enzyme that plays a critical role in bacterial lipoprotein processing pathways. In Synechococcus sp., as in other bacteria, LspA functions by cleaving the signal peptide from prolipoproteins after they have been modified by prolipoprotein diacylglyceryl transferase (Lgt). This cleavage occurs at a specific site before the lipid-modified cysteine residue in the conserved lipobox motif, which typically follows the pattern [LVI][ASTVI][GAS]C .

The processing pathway ensures proper localization and function of lipoproteins, which are important for various cellular processes including membrane integrity and stress responses. Unlike in some pathogenic bacteria where LspA is essential for virulence, the specific physiological roles of LspA-processed lipoproteins in Synechococcus sp. are still being characterized.

How do recombinant forms of Synechococcus sp. LspA differ from the native enzyme?

When expressing recombinant Synechococcus sp. LspA, several important differences from the native enzyme should be considered:

  • Expression tags: Recombinant versions typically include affinity tags (commonly His-tags) at the N-terminus to facilitate purification, which may affect enzyme properties .

  • Expression host: Most recombinant Synechococcus sp. LspA is produced in E. coli rather than the native organism, which can affect protein folding and post-translational modifications .

  • Membrane environment: Native LspA functions in the cyanobacterial membrane environment, which differs from the environments used for in vitro studies of recombinant protein.

  • Activity considerations: Recombinant LspA may require reconstitution in appropriate membrane mimetics (detergents, nanodiscs, or liposomes) to achieve native-like activity for functional studies.

For accurate functional analysis, researchers should consider whether the recombinant form adequately represents the native enzyme's properties in their experimental systems.

What expression systems are most effective for producing active recombinant Synechococcus sp. LspA?

The most effective expression system for producing active recombinant Synechococcus sp. LspA should address the challenges of membrane protein expression. Based on published methodologies:

Expression SystemAdvantagesConsiderations
E. coli BL21(DE3)High yield, widely usedMay require optimization of induction conditions
E. coli C41/C43Designed for membrane proteinsLower yield but better folding
Cell-free systemsAvoids toxicity issuesRequires supplementation with lipids/detergents

Methodology recommendations:

  • Use E. coli as the expression host with an N-terminal His-tag for purification as demonstrated in commercial productions .

  • Express at lower temperatures (16-20°C) to improve folding.

  • Include appropriate detergents (such as LMNG or DDM) during extraction and purification.

  • Consider reconstitution into nanodiscs or liposomes for activity assays.

The evidence from commercial sources indicates that expression in E. coli can yield properly folded protein with >90% purity when appropriate purification strategies are employed .

What assays can be used to measure the enzymatic activity of recombinant Synechococcus sp. LspA?

Several methodological approaches can be employed to assess LspA activity:

  • Gel-shift activity assay: This coupled assay involves monitoring the conversion of pre-prolipoprotein to processed lipoprotein through gel electrophoresis. The method requires:

    • Synthesis of a substrate pre-prolipoprotein

    • Initial processing by Lgt enzyme

    • Addition of purified LspA

    • Detection of size shift via SDS-PAGE

  • FRET-based assays: Using fluorescently labeled peptide substrates containing the lipobox motif to monitor cleavage in real-time.

  • Globomycin resistance assay: This functional complementation assay measures the ability of recombinant LspA to confer resistance to the antibiotic globomycin in E. coli. Increasing concentrations of globomycin (12.5-200 μg/mL) are used to assess functional activity .

  • Genetic complementation: Testing whether recombinant Synechococcus sp. LspA can restore growth of temperature-sensitive E. coli LspA mutants (such as strain Y815) at non-permissive temperatures .

The globomycin resistance assay is particularly useful as it provides a quantitative measure of functional activity and has been validated for LspA from various bacterial species .

How can structural studies of recombinant Synechococcus sp. LspA be optimized?

Structural studies of recombinant Synechococcus sp. LspA present challenges due to its membrane protein nature. Based on successful approaches with other LspA proteins:

  • X-ray crystallography optimization:

    • Remove affinity tags after purification to improve crystallization

    • Use the in meso (lipidic cubic phase) crystallization method, which has been successful for LspA from other species

    • Consider co-crystallization with inhibitors like globomycin to stabilize the protein structure

  • Cryo-EM approach:

    • Reconstitute purified LspA in nanodiscs or amphipols

    • Optimize sample concentration and grid preparation

    • Consider antibody fragment binding to increase particle size

  • NMR studies:

    • Express isotopically labeled protein (15N, 13C)

    • Optimize detergent micelles or nanodiscs for solution NMR

    • Focus on specific domains or peptide interactions

The highest resolution structures obtained for LspA proteins to date have been achieved through X-ray crystallography of inhibitor-bound complexes, suggesting this may be the most promising approach for Synechococcus sp. LspA .

How does Synechococcus sp. LspA compare to LspA from pathogenic bacteria?

Comparative analysis of Synechococcus sp. LspA with LspA from pathogenic bacteria reveals important similarities and differences:

FeatureSynechococcus sp. LspAPathogenic Bacteria LspA (e.g., S. aureus, R. typhi)
Sequence length159-161 amino acidsTypically 160-180 amino acids
Essential natureNon-essentialEssential in many Gram-negative pathogens, non-essential but virulence-associated in some Gram-positives
Catalytic mechanismAspartic protease mechanismAspartic protease mechanism
Inhibitor sensitivitySensitive to globomycinSensitive to globomycin and myxovirescin
Role in virulenceNot associated with virulenceCritical for virulence in many pathogens like M. tuberculosis
Expression levelsConsistent expressionOften shows differential expression during infection stages

How can recombinant Synechococcus sp. LspA be used in antibiotic development research?

Recombinant Synechococcus sp. LspA offers several methodological advantages in antibiotic development research:

  • Safe model system: As a non-pathogenic alternative to LspA from virulent bacteria, it provides a safer platform for initial inhibitor screening.

  • Inhibitor binding studies: The conserved catalytic mechanism makes it useful for studying the binding modes of known LspA inhibitors like globomycin and myxovirescin, which have been shown to inhibit LspA by acting as non-cleavable tetrahedral intermediate analogs .

  • Structure-based drug design: Crystal structures of Synechococcus sp. LspA (when available) can guide the design of novel inhibitors targeting the conserved catalytic site.

  • Resistance mechanism studies: By comparing the effects of mutations in recombinant Synechococcus sp. LspA to those in pathogenic LspA enzymes, researchers can predict potential resistance mechanisms.

A key methodological approach involves using purified recombinant LspA in combination with synthetic substrate analogs to perform high-throughput screening assays for novel inhibitors, followed by validation in more complex cellular systems .

What are common challenges in expressing and purifying recombinant Synechococcus sp. LspA?

Researchers working with recombinant Synechococcus sp. LspA frequently encounter several challenges:

  • Low expression levels: As a membrane protein, LspA often expresses poorly in heterologous systems.

    • Solution: Optimize codons for the expression host, use specialized strains like C41/C43, and induce at lower temperatures (16-20°C).

  • Protein aggregation: Improper folding can lead to inclusion body formation.

    • Solution: Include appropriate detergents during extraction; consider fusion partners that enhance solubility.

  • Loss of activity during purification: The catalytic activity can be compromised during purification steps.

    • Solution: Maintain appropriate detergent concentrations throughout purification; avoid harsh elution conditions.

  • Heterogeneity in detergent micelles: This can interfere with structural and functional studies.

    • Solution: Use size exclusion chromatography to isolate homogeneous protein-detergent complexes; consider reconstitution into nanodiscs.

  • Stability issues: Purified recombinant LspA can be unstable during storage.

    • Solution: Store with glycerol (50%) at -80°C; avoid repeated freeze-thaw cycles as noted in commercial protocols .

These challenges can be addressed through careful optimization of expression conditions, purification protocols, and storage methods.

How can the stability of purified recombinant Synechococcus sp. LspA be improved?

Maximizing the stability of purified recombinant Synechococcus sp. LspA requires careful attention to buffer composition and storage conditions:

  • Buffer optimization:

    • Use Tris/PBS-based buffers at pH 8.0 as recommended for commercial preparations

    • Include 6% trehalose as a stabilizing agent

    • Maintain appropriate detergent concentration above the critical micelle concentration

  • Storage recommendations:

    • Store at -20°C/-80°C with 50% glycerol as a cryoprotectant

    • Aliquot into single-use volumes to avoid repeated freeze-thaw cycles

    • For working solutions, store at 4°C for no more than one week

  • Reconstitution protocol:

    • After lyophilization, reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Centrifuge briefly before opening to bring contents to the bottom of the vial

    • Consider adding stabilizing lipids if the protein will be used for functional assays

These recommendations are based on established protocols for commercial recombinant LspA preparations and can be further optimized for specific experimental requirements .

How can recombinant Synechococcus sp. LspA be used in genetic engineering applications?

Recombinant Synechococcus sp. LspA can be employed in several innovative genetic engineering applications:

  • Markerless genetic manipulation systems: LspA can be used as part of counter-selection strategies in cyanobacterial genetic engineering. Though not directly shown with LspA, similar approaches using other genes demonstrate the potential for employing metabolic enzymes in sophisticated genetic manipulation systems .

  • Reporter protein processing: LspA processing sites can be engineered into fusion proteins to create self-cleaving reporter systems in cyanobacteria.

  • Protein secretion optimization: Understanding LspA function can help in designing improved secretion systems for recombinant protein production in cyanobacteria.

  • Functional complementation: Recombinant Synechococcus sp. LspA can be used to complement LspA mutants in model organisms for studying lipoprotein processing pathways.

For these applications, it's important to consider the following methodological aspects:

  • Design constructs with appropriate promoters for expression in the target organism

  • Include well-characterized signal sequences and lipoboxes for proper recognition

  • Optimize codon usage for the host organism

  • Consider the use of inducible promoters for controlled expression

What methods can be used to study the role of LspA in cyanobacterial stress responses?

To investigate the role of LspA in cyanobacterial stress responses, researchers can employ several methodological approaches:

  • Gene knockout/knockdown studies:

    • Generate LspA deletion mutants in Synechococcus sp. using CRISPR-Cas or markerless gene replacement techniques

    • Create inducible antisense RNA systems to control LspA expression levels

    • Subject mutants to various stress conditions (nutrient limitation, oxidative stress, etc.)

  • Transcriptional analysis:

    • Use quantitative RT-PCR to monitor LspA expression under different stress conditions

    • Perform RNA-seq to identify co-regulated genes during stress responses

    • Compare expression patterns of LspA with other lipoprotein processing genes (like Lgt)

  • Proteomic analysis:

    • Use comparative proteomics to identify changes in the lipoprotein profile between wild-type and LspA mutants

    • Employ pulse-chase experiments to monitor lipoprotein processing during stress

    • Analyze membrane integrity using fluorescent probes

  • Physiological characterization:

    • Assess photosynthetic efficiency using PAM fluorometry

    • Measure growth rates under various stress conditions

    • Analyze cell morphology using microscopy techniques

These approaches can be combined to build a comprehensive understanding of how LspA-mediated lipoprotein processing contributes to stress adaptation in cyanobacteria .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.