Recombinant Synechococcus sp. Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Synechococcus sp. Membrane Protein Insertase YidC (yidC)

Recombinant Synechococcus sp. Membrane Protein Insertase YidC (yidC) is a genetically engineered protein expressed in Escherichia coli for biochemical and structural studies. This protein facilitates the insertion and folding of membrane proteins in cyanobacteria, leveraging conserved mechanisms observed across bacterial YidC homologs . The full-length protein (1-380 amino acids) includes a hexahistidine (His) tag for purification and retains functional domains critical for substrate binding and membrane integration .

Key Properties

PropertyDetails
Source OrganismSynechococcus sp. (strain WH8102)
Expression SystemE. coli
TagN-terminal His tag
FormLyophilized powder
Purity>90% (verified by SDS-PAGE)
Storage-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionDeionized sterile water; glycerol (5-50%) recommended for long-term storage

Amino Acid Sequence Highlights

The recombinant protein (UniProt ID: Q7U522) includes residues critical for catalysis, such as:

  • Residues 50-120: Hydrophobic regions for membrane anchoring.

  • Residues 200-280: Charged residues in the hydrophilic groove for translocating periplasmic domains .

Functional Role in Membrane Protein Biogenesis

YidC operates through two primary mechanisms in Synechococcus:

  1. Independent Insertase Activity: Mediates co-translational insertion of single-pass membrane proteins (e.g., phage coat proteins) via direct interaction with ribosomes .

  2. Collaboration with Sec Translocon: Assists in the folding of multi-pass membrane proteins (e.g., respiratory complexes) by stabilizing transmembrane segments during SecYEG-mediated translocation .

Experimental Findings

  • In vitro assays demonstrate that YidC-enriched membranes enhance insertion efficiency of substrates like Pf3 coat protein by 1.5–1.8-fold .

  • Deletion of YidC in cyanobacteria disrupts thylakoid membrane biogenesis and photosynthetic complex assembly .

Production Workflow

  1. Cloning: yidC gene (SYNW1890) cloned into E. coli expression vectors.

  2. Expression: Induced under optimized conditions for soluble protein yield.

  3. Purification: Affinity chromatography using Ni-NTA resins, followed by buffer exchange .

Applications in Research

  • Membrane Protein Studies: Used to reconstitute insertion pathways for cyanobacterial photosystem I/II subunits .

  • Antibiotic Target Exploration: Hydrophilic groove and greasy slide regions are evaluated for inhibitor binding to combat antibiotic resistance .

  • Lipid Scramblase Activity: Investigated for roles in membrane lipid organization and bilayer asymmetry .

Comparative Analysis with Other YidC Homologs

FeatureSynechococcus YidCBacillus subtilis SpoIIIJ/YidC2E. coli YidC
EssentialityNon-essential in some mutants Conditionally essential Essential
Substrate RangePhotosystem subunits SpoIIIJ-dependent proteins Respiratory complexes
Regulatory PartnersYibN (enhances insertion) MifM (translational sensor) SecYEG/SRP

Challenges and Future Directions

  • Structural Resolution: Full-length Synechococcus YidC lacks a resolved 3D structure, limiting mechanistic insights .

  • Functional Redundancy: Overlap with Sec translocon complicates delineation of YidC-specific roles .

  • Biotechnological Potential: Engineering YidC for synthetic membrane protein production or lipid engineering remains underexplored .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yidC; SYNW1890; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-380
Protein Length
full length protein
Species
Synechococcus sp. (strain WH8102)
Target Names
yidC
Target Protein Sequence
MIGYISDNLLIPILDFFYGLVPSYGLAIVALTIVIRVALYPLSAGSIRSARRMRIAQPVI QKRQAEIKSRYANNLQKQQEELGKVMKEFGSPLAGCLPLLVQMPILFALFATLRGSPFAD VPYTINLKVLPADQIAAVEPKPFNSASHSIFIAETDHVPVIASLPRGTKLGVGDSATVNL HTKDGRGFDDVLTAVDNPSRFAPTWSITKGDDVVNVSDDGTITALTAGDATVEAKIPGLA ARSGFLFIKALGQVGFYADGDINWDIAILVGGFGLTLFLSQLLSGMGMPANPQQATANKI TPVMITGMFLFFPLPAGVLLYMVIANIFQALQTFLLTREALPENLQKILDQQMTQQTVPV TATSAGGGDARLPFEPKGGK
Uniprot No.

Target Background

Function
Essential for the insertion, proper folding, and complex formation of integral membrane proteins within the membrane. It participates in the integration of membrane proteins, both those dependent and independent of the Sec translocase complex, as well as certain lipoproteins. It assists in the folding of multispanning membrane proteins and likely aids in the insertion, folding, and/or assembly of membrane complexes destined for the thylakoid.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what is its fundamental role in Synechococcus sp.?

YidC is a membrane protein insertase belonging to the evolutionarily conserved YidC/Alb3/Oxa1 family, which functions in the insertion and folding of proteins in bacterial cytoplasmic membranes. This protein family is represented across domains of life, with homologs functioning in chloroplast thylakoid membranes (Alb3) and mitochondrial inner membranes (Oxa1) . In cyanobacteria like Synechococcus sp., YidC plays a critical role in the integration of various membrane proteins, including components of the photosynthetic apparatus. YidC can function both independently as a membrane insertase for Sec-independent proteins and cooperatively with the Sec translocase machinery . Recent studies have specifically shown that in Synechococcus species, YidC appears to be involved with SecY in the assembly of Type IV prepilin .

How does the structure of YidC relate to its function in membrane protein insertion?

The structural model of YidC reveals a distinctive arrangement of five conserved transmembrane domains with a helical hairpin between transmembrane segment 2 (TM2) and TM3 on the cytoplasmic membrane surface . This structure creates a hydrophilic groove that is open to the cytosol and penetrates partway into the membrane, unlike SecY which forms a continuous hydrophilic pore across the membrane . This hydrophilic groove is thought to distort and thin the membrane in its vicinity, facilitating the insertion of membrane proteins . The YidC structure allows it to interact with the ribosome at the tunnel exit and provides a site for membrane protein insertion at the YidC protein-lipid interface . This structural arrangement explains how YidC can mediate the membrane integration of newly synthesized proteins by exposing hydrophilic groups to the hydrophobic membrane environment.

What is the evolutionary relationship between YidC and the SecY translocase?

Despite their distinct functions, evidence suggests a unified evolutionary origin for SecY and YidC. Structural analysis reveals striking similarities between the hairpin-interrupted three-TMH motif of YidC and the consensus proto-SecY elements . Each consensus helix from the YidC family can be matched to a consensus helix from proto-SecY with the same connectivity, suggesting YidC as a uniquely good candidate for the origin of proto-SecY . This evolutionary relationship is further supported by the functional similarity between SecY and YidC as mediators of membrane protein integration. The core structures of both proteins facilitate the diffusion of hydrophilic protein segments across the hydrophobic membrane by burying hydrophilic groups inside the membrane . While SecY forms a complete channel, YidC can be considered a "half-channel" that could potentially form a near-complete channel through antiparallel homodimerization .

What are the proven methodologies for purifying and reconstituting YidC for in vitro functional studies?

YidC can be successfully purified and reconstituted into liposomes for in vitro functional studies. Research has demonstrated that YidC reconstituted into liposomes efficiently supports the membrane insertion of purified Pf3 coat protein, a model Sec-independent substrate . The methodology involves:

  • Purification of YidC protein, maintaining its native conformation and activity

  • Preparation of liposomes from phospholipid mixtures mimicking bacterial membrane composition

  • Reconstitution of YidC into these liposomes to form proteoliposomes

  • Verification of correct orientation of YidC in proteoliposomes using protease protection assays

Analysis of reconstituted YidC proteoliposomes should confirm that the protein is oriented with the periplasmic region inside, as evidenced by the appearance of a trypsin-resistant fragment of 42 kDa after protease treatment . This fragment includes the large periplasmic domain between the first two transmembrane regions that can be recognized by peptide-specific antibodies . Optimization of the protein-to-lipid ratio is critical for efficient function, with studies showing that approximately 5-25 YidC molecules per liposome (corresponding to a protein:lipid ratio of 1:25,000) provides optimal insertion activity .

What experimental strategies can be used to identify and characterize YidC substrates in Synechococcus sp.?

Multiple complementary approaches can be employed to identify and characterize YidC substrates in Synechococcus sp.:

  • Genetic knockout studies: Constructing YidC deletion or depletion strains to identify proteins whose membrane integration is affected. For example, studies in Synechococcus sp. PCC 7002 revealed that knocking out Vipp1 (which interacts with thylakoid biogenesis) affects Photosystem I but not Photosystem II assembly, indicating differential substrate requirements .

  • Crosslinking and co-immunoprecipitation: Utilizing chemical crosslinkers followed by co-immunoprecipitation with YidC-specific antibodies to identify interacting substrate proteins.

  • Ribosome profiling: Analyzing ribosome-nascent chain complexes associated with YidC to identify substrates co-translationally interacting with YidC.

  • In vitro reconstitution assays: Testing candidate substrates for YidC-dependent membrane insertion using purified components, as demonstrated with the Pf3 coat protein . These assays can determine if a substrate requires YidC exclusively or if it also depends on the Sec machinery.

  • Comparative proteomics: Analyzing membrane proteome changes in YidC-depleted vs. wild-type cells to identify affected membrane proteins.

These approaches can collectively provide comprehensive identification of YidC-dependent substrates and distinguish between those that require YidC exclusively and those that use YidC in conjunction with the Sec translocase.

How does YidC interact with the ribosome during co-translational membrane protein insertion?

YidC interacts directly with translating ribosomes at the ribosomal tunnel exit to facilitate co-translational membrane protein insertion. Cryo-electron microscopy reconstructions of YidC-ribosome complexes have revealed that a single copy of YidC is sufficient to interact with the ribosome, positioning the nascent membrane protein for direct transfer into the membrane . The structural model of YidC, based on evolutionary co-variation analysis, lipid-versus-protein-exposure and molecular dynamics simulations, has been used to dock into cryo-EM reconstructions of a translating YidC-ribosome complex carrying the YidC substrate F₀c .

This structural arrangement demonstrates that the ribosome-binding surface of YidC positions the emerging nascent chain near the YidC protein-lipid interface, where membrane insertion occurs. The hydrophilic groove of YidC likely interacts with polar segments of the nascent chain, while facilitating the partitioning of hydrophobic transmembrane segments into the lipid bilayer. This mechanism explains how YidC can mediate membrane protein insertion without requiring a complete transmembrane channel, as the protein-lipid interface provides a path of least resistance for membrane protein integration .

What are the functional differences between YidC-dependent and Sec-dependent membrane protein insertion pathways in cyanobacteria?

The YidC and Sec pathways represent distinct but sometimes cooperative mechanisms for membrane protein insertion in cyanobacteria:

FeatureYidC-dependent pathwaySec-dependent pathwayYidC-Sec cooperative pathway
Substrate typesSmall membrane proteins with limited hydrophilic domains (e.g., Pf3 coat protein, Foc)Proteins with large periplasmic domains requiring translocationComplex membrane proteins with both transmembrane segments and periplasmic domains
Energy requirementsSome substrates require membrane potential (ΔΨ)ATP hydrolysis and proton motive forceCombination of energy sources
Insertion mechanismDirect insertion at protein-lipid interfaceChannel-mediated translocation via SecYEGSecYEG translocation with YidC-assisted membrane integration
Example substratesFoc (ATP synthase subunit c), MscL, phage proteins M13 procoat and Pf3 coatSecreted proteins, membrane proteins with large periplasmic domainsATP synthase subunits Foa and Fob, cytochrome bo oxidase subunit 2 (CyoA)

In cyanobacterial systems like Synechococcus, YidC can function both independently and as part of a "holo-enzyme" super-complex containing YidC, the SecYEG channel, and SecDFYajC . This cooperative function is particularly important for complex membrane proteins with multiple transmembrane segments or large periplasmic domains. When working with the Sec machinery, YidC is positioned in close proximity to the SecYEG translocation channel where it can interact with membrane protein substrates as they exit through the lateral gate . This positioning allows YidC to facilitate the integration of transmembrane segments into the lipid bilayer as they emerge from the SecY channel.

What strategies can optimize the expression of recombinant YidC in Synechococcus sp. for functional studies?

Optimizing expression of recombinant YidC in Synechococcus sp. requires addressing several challenges specific to membrane protein expression in photosynthetic organisms:

  • Promoter selection and optimization: The psbA2 promoter has been successfully used for recombinant protein expression in Synechococcus elongatus PCC 7942 . This promoter responds to stress conditions and can be used for controlled expression. Integration of recombinant genes under this promoter has been shown to be effective without causing growth alterations in transgenic strains .

  • Environmental manipulation: Application of specific environmental conditions can enhance recombinant protein expression. For example, exposure to a 30 mT magnetic field (MF30) has demonstrated increased transcription under the psbA2 promoter in Synechococcus elongatus PCC 7942 . This enhancement likely results from stress-induced shifts in gene expression and enzyme activity, affecting the photosynthetic machinery without disrupting the electron transport chain.

  • Codon optimization: Adapting the YidC gene sequence to the codon usage preferences of Synechococcus sp. can significantly improve expression levels.

  • Expression tags and fusions: Incorporating affinity tags (His-tag, FLAG-tag) or fusion partners (like fluorescent proteins) can facilitate both detection and purification of the recombinant YidC protein while potentially improving stability.

  • Growth conditions optimization: Controlling light intensity, CO₂ concentration, and nutrient availability can significantly impact recombinant protein yields in photosynthetic organisms like Synechococcus.

These strategies should be systematically tested and optimized for the specific Synechococcus strain being used, as strain-specific differences in physiology can impact expression outcomes.

What are the current limitations in understanding YidC function in photosynthetic membrane biogenesis?

Several significant challenges limit our comprehensive understanding of YidC function in photosynthetic membrane biogenesis:

  • Complex relationship with thylakoid formation: Studies in Synechococcus sp. PCC 7002 have shown that thylakoid membranes are still produced in the absence of another protein, Vipp1, but with altered morphology resembling those in strains lacking Photosystem I . The precise role of YidC in this complex process remains to be fully elucidated.

  • Substrate specificity determinants: The molecular basis for how YidC recognizes and selectively inserts specific membrane proteins remains poorly understood, particularly for photosynthetic components.

  • Functional redundancy: Potential compensatory mechanisms or partially redundant insertases may exist in cyanobacteria, complicating genetic studies of YidC function.

  • Dynamic regulation: How YidC activity is regulated in response to environmental conditions (light intensity, nutrient availability) that affect photosynthetic membrane composition is not well characterized.

  • Interaction with specialized photosynthetic assembly factors: The interplay between YidC and photosystem-specific assembly factors needs further investigation.

Addressing these limitations will require integrated approaches combining structural biology, in vivo and in vitro functional assays, and systems biology approaches to understand the network of interactions involved in photosynthetic membrane biogenesis.

How can researchers distinguish between direct and indirect effects of YidC mutation on photosystem assembly?

Distinguishing between direct and indirect effects of YidC mutation on photosystem assembly requires a multi-faceted experimental approach:

  • Temporal analysis of assembly defects: Monitoring the kinetics of photosystem assembly defects immediately following YidC depletion can help distinguish primary (direct) from secondary (indirect) effects. Direct substrate effects typically manifest rapidly after depletion.

  • Substrate-specific crosslinking: Using site-specific crosslinkers to detect direct physical interactions between YidC and photosystem components during biogenesis.

  • In vitro reconstitution assays: Testing whether purified YidC directly facilitates membrane insertion of specific photosystem components in a reconstituted system, as has been demonstrated with model substrates like Pf3 coat protein .

  • Complementation analysis: Expressing YidC variants with specific mutations to identify domains critical for interaction with particular photosystem components. For example, complementing a YidC mutant with the orthologous YidC gene from other species, as demonstrated with Synechocystis sp. PCC 6803 YidC expressed in Synechococcus sp. PCC 7002 .

  • Transcriptome and proteome analysis: Examining whether YidC depletion affects transcription or translation of photosystem components. For instance, studies of the Vipp1 mutant in Synechococcus sp. PCC 7002 showed that psaAB transcripts were lower in abundance, indicating an indirect effect on protein production rather than a direct effect on membrane insertion .

One illustrative example comes from studies of the relationship between Vipp1 and Photosystem I in Synechococcus sp. PCC 7002. When the vipp1 mutation was complemented with the orthologous vipp1 gene from Synechocystis sp. PCC 6803 expressed from a strong promoter, PS I content and activities were restored to normal levels, and cells produced thylakoids indistinguishable from wild type . This demonstrates how complementation studies can help distinguish direct functional requirements from indirect effects.

How does YidC from Synechococcus sp. compare functionally with YidC from other bacterial species?

YidC proteins across bacterial species share core functional properties while exhibiting species-specific adaptations:

FeatureYidC in Synechococcus sp.YidC in E. coliYidC in other bacteria
Core functionMembrane protein insertionMembrane protein insertionMembrane protein insertion
Substrate rangePhotosynthetic components and general membrane proteinsPrimarily respiratory chain components and general membrane proteinsSpecies-specific membrane proteome components
Sec cooperationInvolved with SecY in assembly of Type IV prepilin Forms holo-enzyme with SecYEGDF Variable degrees of Sec cooperation
Essential natureCritical for photosynthetic growthEssential for viabilityGenerally essential
Specialized substratesPhotosystem componentsF₁F₀ ATP synthase subunits, NADH-quinone oxidoreductase, cytochrome bo oxidase Species-specific membrane proteins

In E. coli, YidC has been extensively characterized and shown to insert proteins like Foc (subunit c of F₁F₀ ATP synthase), MscL, phage proteins, and TssL . YidC from E. coli has been successfully reconstituted into liposomes and shown to efficiently catalyze the insertion of Pf3 coat protein, with approximately 150 Pf3 coat protein molecules inserted per YidC molecule .

The cyanobacterial YidC in Synechococcus must accommodate the insertion of specialized photosynthetic membrane proteins not present in non-photosynthetic bacteria. While the core insertase mechanism is conserved, cyanobacterial YidC likely has adaptations for the unique architecture of thylakoid membranes and the complex membrane protein composition required for photosynthesis. Studies have shown that in cyanobacteria, both SecY and YidC appear to be involved in the assembly of Type IV prepilin in Synechocystis PCC 6803 , demonstrating both the conservation of cooperative functions and adaptation to specific substrates.

What insights can comparative genomics provide about YidC evolution and specialization in photosynthetic organisms?

Comparative genomics provides valuable insights into YidC evolution and specialization in photosynthetic organisms:

  • Evolutionary conservation: The YidC/Alb3/Oxa1 family is universally conserved across bacteria, chloroplasts, and mitochondria, suggesting ancient evolutionary origins predating the endosymbiotic events that gave rise to eukaryotic organelles . Recent structural analysis suggests a unified evolutionary origin for SecY and YidC, with YidC potentially serving as the ancestral protein from which SecY evolved .

  • Specialization in photosynthetic organisms: Cyanobacteria and chloroplasts contain specialized YidC homologs (Alb3 in chloroplasts) that have adapted to the unique requirements of photosynthetic membrane protein insertion. These adaptations likely include recognition motifs for photosynthesis-specific membrane proteins and interaction domains for photosynthesis-specific assembly factors.

  • Domain architecture: Comparative analysis of YidC proteins across species reveals conserved transmembrane topology with five transmembrane segments constituting the core insertase domain . The large periplasmic domain between TM1 and TM2 shows greater variability between species, suggesting adaptation to specific cellular environments or substrate interactions.

  • Substrate specificity determinants: Sequence variations in the hydrophilic groove region likely reflect adaptations to different substrate repertoires across species. In photosynthetic organisms, these variations may facilitate recognition of light-harvesting complexes and photosystem components.

  • Duplication and specialization: Some bacterial species contain multiple YidC paralogs with specialized functions. Analysis of these paralogs in relation to cyanobacterial YidC can reveal evolutionary patterns of functional diversification.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.