Recombinant Synechococcus sp. NAD (P)H-quinone oxidoreductase subunit 3

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; SynWH7803_0252; NAD(PH-quinone oxidoreductase subunit 3; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3; NDH-1 subunit 3; NDH-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Synechococcus sp. (strain WH7803)
Target Names
ndhC
Target Protein Sequence
MFVLPGYDAFLGFLLIAAAVPVLALVTNKLLAPRSQDGERQLTYESGMEPIGGAWIQFNI RYYMFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALIFIAILVVALAYAWRKGALEWS
Uniprot No.

Target Background

Function

NDH-1 (NAD(P)H-quinone oxidoreductase) facilitates electron transfer from an unidentified electron donor, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory and/or photosynthetic chain. In this organism, plastoquinone is considered the primary electron acceptor. The enzyme couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient. In cyanobacteria, NDH-1 also participates in inorganic carbon concentration.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase subunit 3 and what is its role in cyanobacteria?

NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is a transmembrane protein component of the NDH-1 complex in cyanobacteria such as Synechococcus sp. The NDH-1 complexes belong to the NAD(P)H:Quinone oxidoreductase family, which includes respiratory complex I in bacteria and mitochondria. In cyanobacteria, these complexes play crucial roles in both cyclic electron flow (CEF) around photosystem I and respiration processes. The protein functions by shuttling electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme is believed to be plastoquinone. This electron transport is coupled with proton translocation, which conserves redox energy in a proton gradient .

How does ndhC differ structurally and functionally between Synechococcus sp. and other cyanobacteria?

While the core structure and function of ndhC are conserved across cyanobacteria, there are species-specific variations in sequence, expression patterns, and regulatory mechanisms. In Synechococcus sp., ndhC works in concert with other NDH subunits to facilitate carbon dioxide uptake, along with subunits like ndhD3 and ndhJ . The primary structural differences lie in the transmembrane regions and connection points with other subunits in the NDH-1 complex. These differences can affect electron transport efficiency and the complex's response to environmental changes such as light intensity, carbon dioxide levels, and oxygen concentration. Functional studies require careful consideration of these species-specific characteristics when designing experiments and interpreting results.

What are the recommended expression systems for producing recombinant Synechococcus sp. ndhC?

For expressing recombinant Synechococcus sp. ndhC, several expression systems can be employed, with Escherichia coli being the most commonly used heterologous system. Based on protocols used for similar proteins, the pET expression system with BL21(DE3) strain is recommended. The gene sequence should be codon-optimized for E. coli expression and can be cloned into vectors like pET-28a with appropriate fusion tags (typically an N- or C-terminal His-tag) to facilitate purification. Expression should be induced with IPTG when cultures reach OD600 of 1.0-1.5, followed by incubation at lower temperatures (16-20°C) to enhance proper folding of this transmembrane protein . Alternative expression systems include cell-free expression systems, which have shown success for transmembrane proteins and may be particularly suitable for ndhC as indicated in product information from commercial sources .

What purification challenges are specific to Synechococcus sp. ndhC, and how can they be addressed?

Purification of ndhC presents several challenges due to its transmembrane nature. Key challenges include:

  • Protein solubility: As a transmembrane protein, ndhC requires detergents for solubilization. Recommended detergents include β-DDM (n-dodecyl β-D-maltoside) at 0.03% concentration .

  • Protein stability: The protein may denature during purification. To maintain stability, all buffers should contain appropriate detergents, and purification steps should be performed at 4°C.

  • Contaminant removal: Affinity chromatography using Ni-NTA resin is effective for His-tagged ndhC, but additional purification steps like size-exclusion chromatography are recommended to achieve high purity.

  • Maintaining functional state: The protein should be handled in buffers that mimic its native environment, typically containing phosphate buffer (50 mM NaH2PO4) at physiologically relevant pH (7.0-8.0) .

To address these challenges, a multi-step purification protocol is recommended: initial affinity purification on Ni-NTA, followed by size-exclusion chromatography, with all buffers containing appropriate detergents and protease inhibitors.

What spectroscopic methods are most suitable for studying electron transport activity of recombinant ndhC?

Several spectroscopic methods are appropriate for studying the electron transport activity of recombinant ndhC:

  • Absorbance spectroscopy: Monitoring changes in absorbance at specific wavelengths can track the oxidation state of cofactors involved in electron transport. For NAD(P)H oxidation, absorbance at 340 nm is typically monitored.

  • Fluorescence spectroscopy: Changes in NAD(P)H fluorescence can be used to measure enzyme activity, as NAD(P)H is fluorescent while NAD(P)+ is not.

  • EPR (Electron Paramagnetic Resonance) spectroscopy: Particularly useful for studying the iron-sulfur centers within the NDH complex, providing information about the electronic structure and environment of these centers.

  • Circular dichroism (CD) spectroscopy: Valuable for assessing the secondary structure of the protein and detecting conformational changes during electron transport.

When designing these experiments, it's essential to maintain physiologically relevant conditions, including appropriate pH (typically 7.0-8.0), temperature, and the presence of required cofactors such as NAD(P)H and the electron acceptor plastoquinone .

How can Surface Plasmon Resonance (SPR) be utilized to study interaction partners of Synechococcus sp. ndhC?

Surface Plasmon Resonance (SPR) is a valuable technique for studying protein-protein interactions involving ndhC. The methodology involves:

  • Immobilization: The purified ndhC or NDH complex can be immobilized on a CM5 chip surface (or similar) using amine coupling chemistry, targeting a density of approximately 5000 RU. Non-covalently bound protein should be removed with high salt concentration (e.g., 2 M NaCl) .

  • Running conditions: Prepare multiple running buffers (e.g., 50 mM NaH2PO4, 0.03% β-DDM) at different pH values (pH 6.0, 7.0, and 8.0) to test pH-dependent interactions .

  • Interaction studies: Inject potential interaction partners (such as ferredoxin, plastoquinone, or other NDH subunits) at various concentrations (typically a range of 0.625-20 μM) at a flow rate of 30 μL/min .

  • Data analysis: Analyze binding kinetics using appropriate software (e.g., Biacore evaluation software) by fitting to binding models (commonly 1:1 binding model) .

This approach can determine binding affinities, association and dissociation rates, and the effects of environmental factors (pH, salt concentration) on these interactions, providing valuable insights into the functional networks of ndhC within the photosynthetic apparatus.

How is ndhC gene expression regulated in Synechococcus sp. under different environmental conditions?

The expression of ndhC in Synechococcus sp. is regulated by multiple environmental factors:

  • Oxygen concentration: Transcriptomic analyses show differential expression of NDH complex components under varying dissolved O2 conditions (e.g., 7.1% vs. 16.5%) .

  • Light intensity: As part of the cyclic electron flow machinery, ndhC expression can be modulated by light conditions, with higher expression typically observed under high light intensity that creates excess reducing power.

  • Carbon dioxide availability: Given the role of NDH complexes in carbon dioxide uptake, CO2 concentration affects ndhC expression, with regulatory networks involving other subunits like ndhD3 and ndhJ .

  • Transcriptional regulators: Several transcription factors may bind to the promoter region of ndhC. Analysis techniques include:

    • RNA-seq to quantify expression levels under different conditions, normalized as reads per kilobase per million reads (RPKM)

    • Promoter analysis using tools like Find Individual Motif Occurrences to identify regulatory motifs

    • Network analysis to establish relationships between ndhC and other genes with correlated expression patterns

Understanding these regulatory mechanisms requires integration of transcriptomic data across multiple environmental conditions, coupled with promoter analysis and protein-level studies.

What methodologies are most effective for studying the integration of ndhC into the complete NDH-1 complex?

Several complementary approaches are recommended for studying the integration of ndhC into the NDH-1 complex:

  • Cryo-electron microscopy (cryo-EM): This technique has successfully revealed the structure of NDH complexes at resolutions of 3-3.2 Å, showing the arrangement of subunits and bound cofactors . For Synechococcus sp. ndhC, cryo-EM can determine its position and interactions within the complex.

  • Cross-linking coupled with mass spectrometry: Chemical cross-linking of assembled complexes followed by proteolytic digestion and mass spectrometry analysis can identify interaction points between ndhC and neighboring subunits.

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE): This technique separates intact protein complexes and can reveal subcomplexes formed during assembly or under different conditions.

  • Fluorescence resonance energy transfer (FRET): By tagging ndhC and other subunits with appropriate fluorophores, FRET can monitor protein-protein interactions in real-time, potentially even in vivo.

  • Mutagenesis studies: Systematic mutation of key residues in ndhC can identify those critical for complex assembly and function, providing insights into integration mechanisms.

These approaches should be used in combination, as each provides different but complementary information about the assembly process and final structure of the NDH-1 complex.

How can recombinant Synechococcus sp. ndhC be utilized to study electron transport mechanisms in cyanobacterial photosynthesis?

Recombinant Synechococcus sp. ndhC can serve as a powerful tool for investigating electron transport mechanisms through several advanced approaches:

  • Reconstitution experiments: Purified recombinant ndhC can be used in reconstitution systems with other NDH subunits to create minimal functional units. This allows systematic analysis of the contribution of each component to electron transport.

  • Site-directed mutagenesis: Key residues predicted to be involved in electron transport (based on structural data) can be mutated to analyze their specific roles. This approach can map the electron path through the complex.

  • Electron paramagnetic resonance (EPR) spectroscopy with spin labeling: Strategic introduction of spin labels at specific sites in ndhC can track electron movement through the protein in real-time.

  • Proteoliposome assays: Incorporation of ndhC and other NDH components into liposomes allows measurement of electron transport coupled with proton translocation across membranes, mimicking the native environment.

  • Coupling with artificial electron donors/acceptors: Using modified substrates can help dissect the specificity and mechanism of electron transfer steps.

These approaches can address fundamental questions about directionality of electron flow, coupling mechanisms between electron transport and proton translocation, and the specific role of ndhC in these processes within the context of cyanobacterial photosynthesis .

What are the current challenges in studying the structure-function relationship of ndhC in the context of cyclic electron flow?

Several significant challenges exist in studying the structure-function relationship of ndhC in cyclic electron flow:

  • Protein dynamics: The NDH complex undergoes conformational changes during electron transport. Capturing these dynamic states requires advanced techniques such as time-resolved cryo-EM or single-molecule FRET.

  • Physiological electron donors: While ferredoxin has been identified as an electron donor for the NDH complex, the specific interaction sites with ndhC and transfer mechanisms remain incompletely characterized .

  • Integration of multiple data types: Correlating structural data (from cryo-EM) with functional data (from spectroscopic and biochemical assays) requires sophisticated data integration approaches.

  • Environmental responsiveness: The NDH complex responds to changing environmental conditions, but understanding how these changes affect ndhC specifically requires isolating its contributions from those of other subunits.

  • Heterogeneity of complexes: Cyanobacteria possess several types of NDH complexes (NDH-1L, NDH-1M, NDH-1S) with different subunit compositions . Determining the specific properties of ndhC in each context presents technical challenges.

Addressing these challenges requires interdisciplinary approaches combining structural biology, biochemistry, biophysics, and systems biology. Advanced computational modeling can also help integrate diverse experimental data into coherent mechanistic models.

What are common expression and purification issues with recombinant Synechococcus sp. ndhC, and how can they be resolved?

IssuePossible CausesSolutions
Low expression yieldToxicity to host cells; Codon bias; Protein degradationLower induction temperature (16°C); Use codon-optimized gene sequence; Add protease inhibitors; Use C41(DE3) or C43(DE3) E. coli strains designed for membrane proteins
Inclusion body formationOverexpression; Improper foldingReduce IPTG concentration (0.1-0.5 mM); Include chemical chaperones in growth media; Consider fusion tags that enhance solubility (MBP tag)
Poor solubilizationIneffective detergent; Inappropriate buffer conditionsTest detergent screen (β-DDM, LMNG, digitonin); Optimize detergent concentration; Adjust pH and salt concentration
Loss of activity during purificationDestabilization; Cofactor loss; Oxidation of sensitive residuesInclude stabilizing agents (glycerol 10%); Add reducing agents (DTT or β-mercaptoethanol); Maintain low temperature throughout; Work under nitrogen atmosphere if necessary
Aggregation during storageProtein instability; Detergent concentration below CMCStore with excess detergent; Add cryoprotectants for freeze-thaw stability; Consider storage as small aliquots

Each of these issues requires systematic troubleshooting, often beginning with small-scale expression and purification tests to optimize conditions before scaling up .

How can researchers optimize the functional reconstitution of ndhC into artificial membrane systems for biophysical studies?

Optimizing functional reconstitution of ndhC into artificial membrane systems involves several critical considerations:

  • Lipid composition: The choice of lipids significantly impacts protein functionality. A mixture resembling the native cyanobacterial membrane is ideal, typically including phosphatidylglycerol (PG), phosphatidylcholine (PC), and sulfolipids. Systematic testing of lipid compositions is recommended to identify optimal conditions.

  • Protein:lipid ratio: Typically, start with molar ratios between 1:100 and 1:1000 (protein:lipid). The optimal ratio should be determined empirically for ndhC.

  • Reconstitution method selection:

    • Detergent removal by dialysis: Gentle but time-consuming

    • Adsorption to Bio-Beads: Faster but may affect protein orientation

    • Dilution method: Simple but may result in larger, more heterogeneous proteoliposomes

  • Buffer conditions: The internal and external buffer compositions should be optimized to support protein function, considering pH, salt concentration, and the presence of any required cofactors.

  • Quality control: Before functional studies, reconstituted proteoliposomes should be characterized by:

    • Freeze-fracture electron microscopy to assess protein distribution

    • Dynamic light scattering to determine size distribution

    • Sucrose density gradient to confirm protein incorporation

    • Functional assays to verify activity (e.g., electron transport measurements)

Successful functional reconstitution provides a platform for detailed biophysical studies including proton pumping assays, electron transport measurements, and structural analyses under near-native conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.