Recombinant Synechococcus sp. NAD (P)H-quinone oxidoreductase subunit 3 (ndhC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Synechococcus sp. NAD(P)H-Quinone Oxidoreductase Subunit 3 (ndhC)

Recombinant Synechococcus sp. NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) is a protein derived from the cyanobacterium Synechococcus. This protein is part of the NAD(P)H dehydrogenase complex, which plays a crucial role in electron transport chains, particularly in photosynthetic and respiratory processes. The recombinant form of this protein is often expressed in E. coli for research purposes, facilitating studies on its structure, function, and potential applications in biotechnology.

Structure and Function

The ndhC subunit is one of several components of the NAD(P)H dehydrogenase complex, which is involved in transferring electrons from NAD(P)H to quinones. This process is essential for generating ATP and maintaining redox balance within the cell. The recombinant ndhC protein typically includes a His-tag for easy purification and is expressed in E. coli, allowing for large-scale production and manipulation.

FeatureDescription
Protein Length120 amino acids (1-120aa)
Expression HostE. coli
TagN-terminal His-tag
FunctionElectron transport in photosynthesis and respiration

Applications and Potential

The recombinant ndhC protein can be used in various biotechnological applications, including the study of electron transport mechanisms and the development of novel bioenergetic systems. Its expression in E. coli facilitates genetic engineering approaches aimed at enhancing metabolic efficiency in cyanobacteria for biofuel or chemical production.

ApplicationDescription
BiotechnologyStudy of electron transport mechanisms, bioenergetic system development
Genetic EngineeringEnhancing metabolic efficiency in cyanobacteria for biofuel or chemical production

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance to arrange dry ice shipping; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, and may serve as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; sync_0242; NAD(PH-quinone oxidoreductase subunit 3; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3; NDH-1 subunit 3; NDH-C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-135
Protein Length
full length protein
Species
Synechococcus sp. (strain CC9311)
Target Names
ndhC
Target Protein Sequence
MVYECQTGVQIEAALMFVLPGYDAFLGFLLIAAAVPVLALVTNKLLAPRSQTGERELTYE SGMEPIGGAWIQFNIRYYMFALVFVIFDVETVFLYPWAVAFHRLGLLAFIEALVFITILL VALAYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from an unidentified electron donor, via FMN and iron-sulfur (Fe-S) clusters, to quinones within the respiratory and/or photosynthetic electron transport chain. In this organism, the primary electron acceptor is believed to be plastoquinone. NDH-1 couples this redox reaction to proton translocation, thus conserving redox energy as a proton gradient. In cyanobacteria, NDH-1 also plays a crucial role in inorganic carbon concentration.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

How is the ndhC gene functionally related to photosynthesis in cyanobacteria?

The ndhC gene encodes a subunit of the NAD(P)H-quinone oxidoreductase complex (NDH-1), which plays critical roles in both respiration and photosynthesis in cyanobacteria. Specifically, NDH-1 participates in:

  • Cyclic electron transfer around photosystem I, contributing to ATP generation

  • CO₂ uptake and concentration mechanisms

  • Respiratory electron transport
    Research with Synechococcus PCC 7942 has demonstrated that NDH-1 complexes containing NdhD3/D4 subunits are involved in photosynthetic CO₂ hydration . This function is particularly important for maintaining efficient photosynthesis under varying environmental conditions. The NDH-1 complex helps optimize the balance between linear and cyclic electron flow, allowing cyanobacteria to adapt their photosynthetic machinery to changing light and carbon availability.

What are the known differences in ndhC function between various Synechococcus strains?

Different Synechococcus strains show variable responses in ndhC expression and function, particularly under stress conditions. Transcriptomic studies of Synechococcus sp. strains WH8102, WH8109, and WH7803 during phage infection revealed strain-specific responses in genes related to respiration, including ndhC . While these genes belong to the same general functional groups across different hosts, the actual gene responses are highly host-specific, often associated with genomic islands in the respective hosts .
These differences extend to the subcellular localization and functional importance of NDH components. For instance, immunological analyses have shown that in Anabaena PCC 7120, the NdhK subunit (which functions alongside NdhC) is exclusively present on the plasma membrane, while its distribution may differ in other cyanobacterial species .

What are the optimal methods for genetic manipulation of ndhC in Synechococcus species?

Genetic manipulation of ndhC in Synechococcus species can be achieved through several established methods, with conjugation being one of the most reliable approaches. Based on the research literature, the following protocol has proven effective:
Conjugation Protocol for Synechococcus:

  • Construct an interruption plasmid containing a selectable marker (typically kanamycin or chloramphenicol resistance)

  • Use a non-replicating plasmid in the target cyanobacterium (such as pMUT100 or pDS3 derivatives of pBR322)

  • Mobilize the plasmid into Synechococcus using a conjugative strain such as Escherichia coli MC1061 carrying helper plasmids (e.g., pRK24 and pRL528)
    For Synechococcus PCC 7942 specifically, natural transformation procedures have been optimized and can be more efficient than conjugation in some cases. When designing gene interruption constructs, it's critical to ensure sufficient homologous flanking sequences (typically 500-1000 bp on each side) to facilitate efficient recombination.
    The choice of promoters is also crucial for successful expression of recombinant constructs. Studies have shown that the psbA2 promoter, which responds to stress conditions, is effective for recombinant protein expression in Synechococcus elongatus PCC 7942 .

How can researchers assess the functional impact of ndhC mutations in Synechococcus?

Assessment of ndhC mutations requires a multi-parameter approach to capture the diverse physiological roles of the NDH-1 complex. The following methodological framework is recommended:
Functional Assessment Protocol:

  • Growth analysis

    • Compare growth rates under photoautotrophic, mixotrophic, and heterotrophic conditions

    • Measure growth under varying CO₂ concentrations (ambient vs. elevated)

    • Test growth under fluctuating light conditions to assess cyclic electron flow capacity

  • Photosynthetic parameter measurements

    • Oxygen evolution (Clark-type electrode)

    • Chlorophyll fluorescence (PAM fluorometry) to assess:

      • Maximum quantum yield (Fv/Fm)

      • Effective quantum yield (ΦPSII)

      • Non-photochemical quenching (NPQ)

    • P700 redox kinetics to evaluate cyclic electron flow

  • Biochemical analyses

    • NDH-1 complex assembly (Blue Native PAGE)

    • In-gel activity assays

    • Immunoblotting with antibodies raised against NDH-1 subunits

  • CO₂ uptake measurements

    • Membrane inlet mass spectrometry

    • Isotopic labeling with ¹³C
      It's important to note that complete inactivation of ndhC may be lethal in some cyanobacterial strains, as suggested by research on the related ndhK gene in Anabaena PCC 7120, where researchers were unable to segregate transformants with an interrupted ndhK gene .

What are the most reliable methods for quantifying ndhC expression levels?

Accurate quantification of ndhC expression requires selection of appropriate methods based on research objectives. The following approaches are recommended:
Quantitative Expression Analysis Methods:

  • RT-qPCR

    • Most sensitive method for transcript quantification

    • Requires careful primer design to ensure specificity

    • Essential controls:

      • Multiple reference genes (rnpB, secA, petB recommended for Synechococcus)

      • No-template and no-RT controls

      • Standard curves for absolute quantification

  • RNA-Seq

    • Provides comprehensive transcriptomic context

    • Allows identification of co-regulated genes

    • Reveals operon structure and potential antisense transcripts

  • Protein-level quantification

    • Western blotting with specific antibodies

    • Mass spectrometry-based proteomics (SWATH-MS or TMT labeling)

    • Activity assays for NDH-1 complex function

  • Reporter gene fusions

    • Translational fusions with fluorescent proteins

    • Particularly useful for localization studies

    • Can be combined with flow cytometry for high-throughput analysis
      When analyzing ndhC expression, it's crucial to consider the environmental conditions, as expression can vary significantly in response to light intensity, carbon availability, and other stressors . Standardized growth conditions are essential for reproducible results.

How do NDH-1 complexes containing NdhC interact with stress response mechanisms in Synechococcus?

The NDH-1 complexes containing NdhC play significant roles in cyanobacterial stress responses, particularly against oxidative stress. Research indicates complex interactions between NDH-1 function and cellular redox systems:
NDH-1 and Oxidative Stress Response:
The glutathione system is central to cyanobacterial responses to reactive oxygen species (ROS). This system comprises glutathione tripeptide (gamma-glutamyl-cysteinyl-glycine) and various glutathione-dependent enzymes that have been conserved during evolution . NDH-1 complexes contribute to redox homeostasis by:

  • Influencing the NAD(P)H/NAD(P)⁺ ratio, which affects cellular redox state

  • Participating in cyclic electron flow that can alleviate excess excitation energy

  • Potentially undergoing glutathionylation as a regulatory mechanism
    In Synechocystis PCC 6803, approximately 400 proteins can be glutathionylated in vitro, participating in a wide range of cellular processes including carbon and nitrogen metabolism, cell division, stress responses, and hydrogen production . This glutathionylation/deglutathionylation process and the associated glutathione transferase and glutaredoxin enzymes have been conserved evolutionarily from cyanobacteria to plants and humans .
    The NDH-1 complex components may serve as targets for redox regulation, allowing cyanobacteria to adjust electron flow in response to environmental stresses. This regulatory mechanism appears to be strain-specific and may contribute to the differential stress tolerance observed among Synechococcus strains.

What are the challenges in expressing recombinant NdhC in heterologous systems, and how can they be overcome?

Expression of recombinant NdhC in heterologous systems presents several challenges due to its membrane-associated nature and its role within a multi-subunit complex. These challenges and potential solutions include:
Challenges in Heterologous Expression:

  • Membrane integration issues

    • NdhC is a hydrophobic protein requiring proper membrane insertion

    • Solution: Use specialized expression systems with membrane-targeting signals or express as a fusion with soluble tags

  • Complex assembly requirements

    • NdhC functions as part of the larger NDH-1 complex

    • Solution: Co-express multiple NDH-1 subunits or use hosts that contain compatible NDH-1 components

  • Protein folding and stability

    • Membrane proteins often have folding challenges in heterologous systems

    • Solution: Express at lower temperatures (16-20°C) and use specialized E. coli strains (C41/C43)

  • Functional assessment

    • Difficult to assess functionality outside of native context

    • Solution: Develop reconstitution systems or complementation assays
      For expression in E. coli, fusion with glutathione S-transferase (GST) has proven effective for some NDH-1 components . When expressing in cyanobacterial hosts, selection of appropriate promoters is critical - the psbA2 promoter has shown good results for recombinant protein expression in Synechococcus elongatus PCC 7942 .
      Recent research has demonstrated that physical factors such as magnetic field application (30 mT) can enhance recombinant protein production in Synechococcus elongatus PCC 7942 , offering a novel approach to improving yields.

How does the genomic context of ndhC influence its function across different cyanobacterial strains?

The genomic context of ndhC shows significant variation across cyanobacterial strains, influencing its regulation and function in distinct ecological niches. Comparative genomic analyses reveal:
Genomic Context Variations:

  • Operon structure

    • While ndhC is generally part of the ndhC-K-J operon, the intergenic regions vary considerably

    • In Anabaena PCC 7120, ndhC and ndhK coding regions overlap by 7 bp

    • In Synechocystis PCC 6803, a 71-bp non-coding spacer separates these genes

  • Genomic islands

    • Many stress-responsive genes, including those related to NDH-1 function, are located in hypervariable genomic islands

    • These islands often contain strain-specific genes that contribute to adaptation to particular environments

  • Regulatory elements

    • Promoter regions and transcription factor binding sites show strain-specific patterns

    • These differences contribute to differential expression responses under stress conditions
      The functional consequences of these genomic context differences include:

  • Altered transcriptional responses to environmental cues

  • Different co-regulation patterns with other metabolic genes

  • Potential impacts on translation efficiency due to variations in ribosome binding sites

  • Evolutionary flexibility allowing adaptation to diverse ecological niches
    Research comparing closely related cyanobacteria has revealed that these genomic differences can predict phenotypic variations, such as the observation that Synechocystis PCC 6803 is more resistant to zinc excess than Synechocystis PCC 6714 .

How has the function of ndhC evolved across cyanobacterial lineages and into chloroplasts?

The evolutionary trajectory of ndhC from cyanobacteria to chloroplasts reflects the endosymbiotic origin of plastids and reveals functional adaptations across diverse photosynthetic lineages:
Evolutionary Conservation and Divergence:

  • Structural conservation

    • Core components of NDH-1, including NdhC, show remarkable sequence conservation

    • Gene organization (ndhC-K-J operon) is preserved in many cyanobacteria and chloroplasts

    • In both cyanobacteria and chloroplasts, the ndhC and ndhK coding regions can overlap (7 bp overlap in Anabaena PCC 7120, similar to liverwort, maize, and rice chloroplasts)

  • Functional specialization

    • Cyanobacterial NDH-1 functions in both respiration and photosynthesis

    • Chloroplast NDH-1 has lost respiratory functions but retained roles in cyclic electron flow

    • Some algal lineages have lost chloroplast ndh genes entirely, evolving alternative mechanisms

  • Regulatory adaptation

    • Expression control mechanisms have diverged significantly

    • Light regulation patterns differ between cyanobacteria and plants
      Comparative genomic studies have positioned cyanobacteria as a unique evolutionary hub between anaerobes and obligate aerobes . The earliest cyanobacteria were likely small and unicellular, with filamentous forms appearing shortly thereafter . Understanding ndhC evolution provides insights into the adaptation of photosynthetic electron transport to diverse environmental conditions across evolutionary time.

What can comparative studies of ndhC mutants across different Synechococcus strains tell us about its functional significance?

Comparative analysis of ndhC mutants across different Synechococcus strains reveals critical insights into the functional plasticity and importance of this gene in cyanobacterial physiology:
Cross-Strain Comparative Findings:

  • Essentiality variations

    • While complete inactivation of some NDH-1 components (like ndhK in Anabaena PCC 7120) appears lethal , other strains may tolerate partial NDH-1 impairment

    • These differences suggest variable dependence on NDH-1 function for survival across strains

  • Physiological impact patterns

    • CO₂ uptake efficiency

    • Cyclic electron flow capacity

    • Growth under fluctuating light conditions

    • Stress tolerance profiles

  • Compensatory mechanisms

    • Some strains exhibit greater capacity to compensate for NDH-1 deficiencies

    • Alternative electron transport pathways may be more developed in certain strains
      The results of comparative mutant studies suggest that while ndhC and the NDH-1 complex serve conserved core functions across cyanobacteria, the relative importance of these functions and the availability of alternative mechanisms vary significantly. This functional plasticity likely contributes to the ecological distribution and stress tolerance of different Synechococcus strains.
      A comprehensive comparative study would ideally include physiological measurements under identical conditions across multiple strains with precisely constructed mutations, which has not yet been reported in the literature.

How do NDH-1 complexes in Synechococcus compare with similar complexes in other organisms regarding subunit composition and function?

NDH-1 complexes show fascinating structural and functional variations across organisms, with Synechococcus exhibiting unique adaptations related to its photosynthetic lifestyle:
Comparative Analysis of NDH-1 Complexes:

Organism TypeComplex DesignationApproximate SubunitsUnique FeaturesPrimary Functions
SynechococcusNDH-111-17Multiple distinct complexes (NDH-1L, NDH-1M, NDH-1S)Cyclic electron flow, CO₂ uptake, Respiration
Other CyanobacteriaNDH-111-17Species-specific subunit variationsSimilar to Synechococcus
Plant ChloroplastsNDH25+Additional subunits not found in cyanobacteriaCyclic electron flow, Chlororespiration
MitochondriaComplex I14-45Highly elaborate structureRespiratory electron transport
E. coliNDH-113-14Simpler structureRespiratory electron transport
In Synechococcus and other cyanobacteria, NDH-1 complexes exhibit remarkable functional versatility compared to their counterparts in other organisms. Unique features include:
  • Multiple distinct NDH-1 complexes with different subunit compositions

  • NdhD/NdhF subunit variations creating functional diversity

  • Direct involvement in CO₂ uptake mechanisms not found in non-photosynthetic bacteria
    The cyanobacterial NDH-1 complexes represent an evolutionary intermediate between the simpler bacterial forms and the more elaborate structures found in chloroplasts and mitochondria. This evolutionary position is reflected in both structural features and functional capabilities .

What are the most promising approaches for engineering ndhC to enhance photosynthetic efficiency in Synechococcus?

Engineering ndhC and related NDH-1 components offers promising avenues for enhancing photosynthetic performance in Synechococcus, with several strategic approaches showing potential:
Engineering Strategies:

  • Overexpression approaches

    • Controlled upregulation of ndhC using inducible promoters

    • Co-expression with other limiting NDH-1 subunits

    • Expected outcome: Enhanced cyclic electron flow capacity and improved ATP/NADPH ratio control

  • Directed evolution

    • Random mutagenesis followed by selection under fluctuating light conditions

    • Continuous culture under CO₂-limiting conditions

    • Expected outcome: NdhC variants with improved functional properties

  • Rational design based on structural insights

    • Modification of key residues involved in quinone binding

    • Engineering proton pumping efficiency

    • Expected outcome: Enhanced coupling efficiency and electron transfer rates

  • Heterologous NDH component introduction

    • Import functionally enhanced ndhC variants from other cyanobacteria

    • Create chimeric proteins combining domains from different sources

    • Expected outcome: Novel functional properties adapted to specific conditions

  • Regulatory optimization

    • Engineering transcriptional and post-translational regulation

    • Designing synthetic regulatory circuits for environment-responsive expression

    • Expected outcome: Dynamic optimization of NDH-1 activity based on environmental conditions
      Preliminary studies using the psbA2 promoter for recombinant protein expression in Synechococcus elongatus PCC 7942 have demonstrated successful integration strategies . Additionally, physical approaches such as magnetic field application (30 mT) have shown promise in enhancing recombinant protein production .

How might systems biology approaches advance our understanding of ndhC function in cyanobacterial metabolism?

Systems biology offers powerful frameworks for understanding the complex integration of ndhC function within the broader metabolic network of Synechococcus:
Systems Biology Approaches:

  • Multi-omics integration

    • Combining transcriptomics, proteomics, and metabolomics data

    • Correlation of ndhC expression patterns with global metabolic shifts

    • Construction of predictive models linking NDH-1 activity to metabolic outputs

  • Genome-scale metabolic modeling (GSM)

    • Incorporation of NDH-1 reactions into existing cyanobacterial GSMs

    • Flux balance analysis to predict metabolic consequences of ndhC modifications

    • In silico testing of engineering strategies

  • Regulatory network mapping

    • Identification of transcription factors controlling ndhC expression

    • Characterization of post-translational modifications affecting NdhC function

    • Construction of signal transduction maps connecting environmental cues to NDH-1 activity

  • Synthetic biology implementations

    • Development of genetic circuits for precise control of ndhC expression

    • Creation of biosensors reporting on NDH-1 activity

    • Design of minimal systems for studying NDH-1 function in isolation
      Genome-scale models have already been developed for several cyanobacteria, including Synechocystis PCC 6803, to predict which metabolic reactions or pathways should be engineered to increase production of biotechnologically interesting chemicals . Extending these approaches to focus specifically on ndhC and NDH-1 function represents a promising research direction.

What are the implications of ndhC research for understanding cyanobacterial adaptation to changing environmental conditions?

Research on ndhC provides critical insights into cyanobacterial adaptation mechanisms, with broad implications for understanding how these organisms respond to environmental changes:
Environmental Adaptation Implications:

  • Climate change responses

    • NDH-1 complexes play key roles in carbon concentration mechanisms

    • Understanding ndhC function may help predict how cyanobacteria will respond to rising CO₂ levels

    • NDH-1 involvement in cyclic electron flow provides adaptation to fluctuating light conditions

  • Stress tolerance mechanisms

    • Links between NDH-1 function and oxidative stress responses suggest roles in multiple stress adaptations

    • Strain-specific differences in ndhC may contribute to differential stress tolerance

    • The glutathione system interacts with NDH-1 complexes in protecting against oxidative and metal stresses

  • Evolutionary adaptability

    • Comparative genomic analyses reveal that NDH-1 components exist in genomic islands with higher evolutionary rates

    • This genomic context allows for rapid adaptation to new environmental conditions

    • Host-specific responses of respiratory genes including ndhC during phage infection suggest roles in biotic stress responses

  • Ecological distribution determinants

    • Different Synechococcus ecotypes show variations in NDH-1 components

    • These variations likely contribute to the global distribution patterns of Synechococcus strains

    • Understanding ndhC function may help explain niche partitioning in marine ecosystems The research on ndhC and NDH-1 complexes continues to reveal how these fundamental components of cyanobacterial metabolism contribute to their remarkable ecological success and evolutionary persistence across billions of years of environmental change.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.