Recombinant Synechococcus sp. NAD (P)H-quinone oxidoreductase subunit 4L (ndhE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by several factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is established during the production process. If you have a specific tag type requirement, please communicate this to us, and we will prioritize developing the specified tag.
Synonyms
ndhE; CYA_1630; NAD(PH-quinone oxidoreductase subunit 4L; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L; NDH-1, subunit 4L; NDH-E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Synechococcus sp. (strain JA-3-3Ab) (Cyanobacteria bacterium Yellowstone A-Prime)
Target Names
ndhE
Target Protein Sequence
MLQLQFFLVVAAILFCIGIYGLIVSRNAIRVLMSIELMLNAVNLNFMAFSNFVDSGLIRG QVFSVFVITVAAAEAAVGLAIVLGIYRNRATIDMESFNLLRW
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from an unidentified electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory and/or photosynthetic chain. In this specific organism, plastoquinone is believed to be the immediate electron acceptor for the enzyme. NDH-1 couples the redox reaction with proton translocation, thus conserving the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon concentration.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • What role does NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) play in cyanobacterial adaptation to environmental stress?

NAD(P)H-quinone oxidoreductase subunit 4L (ndhE), as a component of the NDH-1 complex, is integral to cyanobacterial stress response mechanisms, particularly under challenging environmental conditions:

High Light and High Temperature (HLHT) Adaptation:

  • NDH-1 complexes contribute significantly to photosynthetic electron flow regulation under HLHT stress

  • Under severe HLHT conditions (42°C and 2500 μmol photons/m²/s), specific NDH-1 configuration adjustments help maintain photosynthetic efficiency

  • Studies with engineered hypermutation systems in Synechococcus elongatus have identified that alterations in NDH-1 complex genes can confer improved HLHT tolerance

Inorganic Carbon Fluctuations:

  • NDH-1 complexes containing ndhE are crucial components of the Carbon Concentration Mechanism (CCM)

  • Euryhaline strains like Synechococcus sp. PCC 7002, which experience habitat fluctuations in coastal environments, utilize CCM regulation to adapt to changing carbon availability

  • Transcriptional regulation of CCM activity mediated by LysR family transcriptional regulators (like CcmR) directly affects NDH-1 complex functionality

Experimental Data from Adaptation Studies:

Environmental ConditionNDH-1 Complex ResponsePhysiological OutcomeReference
High light (2500 μmol photons/m²/s)Increased NDH-1₃ expressionEnhanced CO₂ fixation efficiency
High temperature (42-45°C)Restructuring of NDH-1 complexesImproved photosystem II stability
Low CO₂ conditionsInduction of high-affinity NDH-1₃Maintained carbon fixation rates
Combined HLHT stressModifications to electron transport chainSurvival and growth under severe conditions

Molecular Mechanisms:

  • Transcriptional upregulation of NDH-1 complex components (including ndhE) under stress conditions

  • Post-translational modifications of NDH-1 subunits affecting complex assembly and function

  • Altered protein-protein interactions within the NDH-1 complex

  • Changes in thylakoid membrane composition affecting NDH-1 complex stability and activity

Research with hypermutation systems has demonstrated that adaptive modifications to NDH-1 complexes can provide up to 3-fold increased survival rates under extreme HLHT conditions (45°C and 2500 μmol photons/m²/s), highlighting the critical role of these complexes in stress adaptation .

  • How do mutations in NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) affect photosynthetic efficiency in Synechococcus sp.?

Mutations in NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) have profound effects on photosynthetic machinery function and efficiency in Synechococcus sp., impacting multiple photosynthetic processes:

Impact on Photosynthetic Electron Transport:

Mutation TypeEffect on Electron TransportPhysiological ConsequenceDetection Method
Loss-of-functionDisrupted cyclic electron flow around PSIReduced ATP/NADPH ratioPAM fluorometry
Site-specificAltered NDH-1 complex assemblyVariable electron transport ratesP700 absorbance
OverexpressionEnhanced cyclic electron flowIncreased ATP productionOxygen evolution
Regulatory regionChanged expression patternsContext-dependent effectsTranscriptomics

CO₂ Assimilation Effects:

  • Mutations affecting ndhE function disrupt the carbon concentration mechanism (CCM)

  • Impaired CO₂ to HCO₃⁻ conversion within specialized NDH-1 complexes

  • Reduced carbon fixation rates, particularly under limiting CO₂ conditions

  • Altered regulation of genes in the CCM regulon, including those encoding bicarbonate transporters

Methodology for Studying Mutation Effects:

  • Genetic Approaches:

    • CRISPR/Cas-based genome editing to create specific mutations

    • Generation of knockout mutants using homologous recombination

    • Site-directed mutagenesis of conserved residues

    • Complementation studies with wild-type or mutant alleles

  • Phenotypic Analysis:

    • Oxygen evolution measurements under varying light intensities and CO₂ concentrations

    • Chlorophyll fluorescence analysis (Fv/Fm, NPQ, electron transport rate)

    • Growth rate determination under different environmental conditions

    • 14C incorporation assays to measure carbon fixation rates

  • Molecular Characterization:

    • Blue native PAGE to assess NDH-1 complex assembly

    • Western blotting to quantify protein levels

    • Co-immunoprecipitation to identify altered protein-protein interactions

    • Transcriptomic and proteomic analyses to identify compensatory responses

Research on NDH-1 complex mutants shows that strains lacking functional ndhE exhibit up to 40% reduction in cyclic electron flow capacity and a corresponding 25-35% decrease in CO₂ fixation rates under limiting CO₂ conditions, demonstrating the critical role of this subunit in maintaining photosynthetic efficiency .

  • What methods are most effective for studying NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) protein-protein interactions within the NDH-1 complex?

Investigating protein-protein interactions involving NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) requires specialized approaches due to its membrane-embedded nature and role within the NDH-1 complex:

Complementary Methodological Approaches:

MethodTechnical ApproachAdvantagesLimitationsSample Preparation
Chemical Cross-linking MSIn vivo or in vitro crosslinking followed by MS analysisCaptures native interactionsComplex data analysisGentle cell lysis with crosslinker
Blue Native PAGEDetergent solubilization followed by native gel electrophoresisPreserves intact complexesLimited resolutionCareful detergent selection
Co-immunoprecipitationPull-down with antibodies against ndhE or partnersIdentifies complex componentsRequires specific antibodiesOptimized membrane solubilization
Bacterial two-hybridSplit reporter proteins fused to potential interactorsWorks in prokaryotic systemsMay give false positivesCloning fusion constructs
FRET analysisFluorophore-tagged proteins expressed in vivoDetects interactions in living cellsRequires protein taggingCareful fluorophore placement
Surface Plasmon ResonancePurified proteins analyzed for binding kineticsProvides quantitative dataRequires purified componentsDetergent-solubilized proteins

Specialized Approaches for Membrane Proteins:

  • Detergent Screening Protocol:

    • Test multiple detergents (DDM, LMNG, LDAO) at various concentrations

    • Assess protein complex integrity by size exclusion chromatography

    • Select conditions that maintain native interactions while solubilizing membranes

  • Reconstitution Systems:

    • Nanodiscs: Phospholipid bilayers stabilized by scaffold proteins

    • Liposomes: Artificial lipid vesicles with incorporated membrane proteins

    • Amphipols: Amphipathic polymers that stabilize membrane proteins

  • Advanced MS Techniques:

    • Hydrogen-deuterium exchange MS to map interaction interfaces

    • Native MS to analyze intact membrane protein complexes

    • Crosslinking-MS to identify proximity relationships between subunits

Data Interpretation Framework:

  • Classify interactions as direct (physical contact) or indirect (within same complex)

  • Map interaction sites to protein structural domains

  • Correlate interaction data with functional assays

  • Validate key interactions through mutagenesis studies

Recent research employing crosslinking-MS approaches has identified multiple interaction sites between ndhE and other NDH-1 subunits, revealing that ndhE forms direct contacts with at least three other subunits (ndhD, ndhF, and ndhB) and contributes to the structural core that maintains complex integrity. Disruption of these interaction surfaces through site-directed mutagenesis results in impaired complex assembly and reduced NDH-1 activity .

  • How does the regulation of NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) expression differ across environmental conditions and Synechococcus strains?

The expression of NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) exhibits significant variability across environmental conditions and between different Synechococcus strains, reflecting adaptation to diverse ecological niches:

Environmental Regulation Patterns:

Environmental FactorRegulatory ResponseRegulatory MechanismTimeframeDetection Method
CO₂ limitationUpregulationTranscriptional activation30-60 minRT-qPCR, Northern blot
High light intensityContext-dependentPost-transcriptional15-120 minProteomics, Western blot
High temperatureStrain-specific changesTranscriptional/translational60-180 minRNA-seq, ribosome profiling
Diel cyclesCircadian regulationKai-based oscillator24-hour cycleTime course transcriptomics

Strain-Specific Regulation:

  • Euryhaline strains (e.g., Synechococcus sp. PCC 7002) show rapid transcriptional responses to changes in carbon availability

  • Open ocean strains exhibit more stable expression patterns adapted to consistent environments

  • Coastal strains demonstrate enhanced regulatory flexibility to accommodate fluctuating conditions

Regulatory Mechanisms:

  • Transcriptional Control:

    • LysR-type transcriptional regulators (like CcmR) directly influence expression of NDH-1 components

    • RIF (rifampin) treatment studies show rapid transcriptional responses (within 30 minutes) to changes in CO₂ availability

    • Circadian regulation through the Kai-based oscillator affects expression in Synechococcus elongatus PCC 7942

  • Post-Transcriptional Regulation:

    • mRNA stability differences between strains affect protein expression levels

    • Translational efficiency influenced by ribosome binding site accessibility

    • Small RNAs potentially involved in fine-tuning expression under stress conditions

Methodological Approaches to Study Regulation:

  • Comparative Transcriptomics:

    • RNA-seq analysis across conditions and strains

    • Time-course experiments to capture temporal dynamics

    • Integration with chromatin immunoprecipitation (ChIP-seq) data to identify regulatory elements

  • Promoter Analysis:

    • Reporter gene assays with ndhE promoter variants

    • DNA-protein interaction studies (electrophoretic mobility shift assays)

    • Mutational analysis of regulatory regions

Research on Synechococcus elongatus PCC 7942 has identified that approximately 30% of genes, including components of the NDH-1 complex, exhibit circadian regulation with peaks at either subjective dawn or dusk. The ndhE gene specifically shows moderate amplitude oscillation with peak expression at subjective dawn, coordinated with other components of the photosynthetic apparatus .

  • What are the current challenges and future directions in engineering NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) for enhanced photosynthetic performance?

Engineering NAD(P)H-quinone oxidoreductase subunit 4L (ndhE) for improved photosynthetic performance presents both significant challenges and promising opportunities for advancing cyanobacterial biotechnology:

Current Technical Challenges:

Challenge CategorySpecific IssuesPotential SolutionsResearch Priority
Structural constraintsLimited structural data on ndhE within NDH-1 complexCryo-EM studies of intact complexesHigh
Functional redundancyMultiple NDH-1 complexes with overlapping functionsSystem-level engineering approachesMedium
Genetic stabilityMaintaining engineered modificationsMarkerless mutation systemsHigh
Expression optimizationBalancing expression with other complex componentsPromoter libraries and tunable systemsMedium
Phenotypic assessmentMeasuring subtle changes in photosynthetic performanceAdvanced chlorophyll fluorescence techniquesMedium

Innovative Engineering Approaches:

  • Structure-Guided Protein Engineering:

    • Targeted modification of residues involved in electron transport

    • Enhancement of complex stability through interface engineering

    • Alteration of regulatory domains to modify environmental responses

  • Adaptive Laboratory Evolution (ALE) Combined with Hypermutation:

    • Engineered hypermutation systems to accelerate adaptive evolution

    • Selection under specific environmental conditions (HLHT tolerance)

    • Identification of beneficial mutations for subsequent rational engineering

  • Synthetic Biology Strategies:

    • Introduction of heterologous NDH-1 components from extremophilic cyanobacteria

    • Development of chimeric NDH-1 complexes with enhanced properties

    • Creation of orthogonal electron transport pathways

Future Research Directions:

  • Integration with Carbon-Concentrating Mechanisms:

    • Engineering NDH-1 complexes for enhanced CO₂ to HCO₃⁻ conversion

    • Coupling improved NDH-1 function with engineered Rubisco

    • Co-optimization of carbon uptake, fixation, and electron transport

  • Environmental Adaptation Applications:

    • Development of strains with improved tolerance to climate change conditions

    • Engineering strains for cultivation in extreme environments

    • Creation of robust production platforms for biofuels and chemicals

  • Advanced Genetic Tools:

    • CRISPR-based genome editing for precise modifications

    • Site-specific recombinase systems for markerless engineering

    • Development of inducible/repressible expression systems specific for NDH-1 components

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.