Recombinant Synechococcus sp. Photosystem I reaction center subunit XI (psaL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psaL; syc1761_d; Photosystem I reaction center subunit XI; PSI subunit V; PSI-L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) (Anacystis nidulans)
Target Names
psaL
Target Protein Sequence
AQDVIANGGTPEIGDLATPTNSSPFTRTFINALPIYRRGLSSNRRGLEIGMAHGFLLYGP LSILGPLRNTETAGSAGLLATVGLVVILTVCLSLYGNAGSGPSAAESTVTTPNPPQELFT KEGWSEFTSGFILGGLGGAFFAFYLASTPYVQPLVKIAAGVWSVH
Uniprot No.

Target Background

Database Links
Protein Families
PsaL family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is psaL and what is its role in Photosystem I?

PsaL is the Photosystem I reaction center subunit XI, an integral protein component of the photosynthetic apparatus. Functionally, psaL plays a critical role in the organization and stability of Photosystem I (PSI), which serves as a highly efficient sunlight energy converter in oxygenic photosynthesis. PSI catalyzes light-driven electron transport from plastocyanin at the luminal face of the membrane to ferredoxin on the stromal side, ultimately supporting NADPH production for carbon fixation. The remarkable quantum efficiency of PSI, approaching nearly 100% in light utilization for electron transport, makes it one of nature's most effective photoelectric systems .

The psaL subunit specifically contributes to the structural integrity of PSI and has been identified in the improved crystallographic model of plant Photosystem I at 3.3-Å resolution . Understanding psaL's structure-function relationship is essential for comprehensive knowledge of photosynthetic mechanisms.

How is recombinant psaL typically produced for research applications?

Recombinant psaL can be produced by expressing the psaL gene in heterologous systems, most commonly Escherichia coli. The standard procedure involves:

  • Cloning the full-length coding sequence (1-166 amino acids) into an expression vector

  • Adding an N-terminal His-tag to facilitate purification

  • Transforming the construct into E. coli expression strains

  • Inducing protein expression under controlled conditions

  • Lysing cells and purifying the protein using affinity chromatography

  • Storing as lyophilized powder or in appropriate buffer conditions with 6% trehalose at pH 8.0

For long-term storage, the purified protein is recommended to be stored at -20°C/-80°C with 5-50% glycerol to prevent degradation. Repeated freeze-thaw cycles should be avoided to maintain protein integrity and activity .

How can the XylS/Pm expression system be optimized for high-yield psaL production?

The XylS/Pm regulator/promoter system offers significant advantages for recombinant psaL expression, particularly for researchers seeking enhanced yields. This system has demonstrated effectiveness across diverse Gram-negative bacterial species with broad temperature tolerance .

For optimal psaL expression using this system:

  • Promoter Engineering: Random mutagenesis of the Pm promoter region can generate variants with up to 10-fold increased expression levels. Specifically, doped oligonucleotides, error-prone PCR, and DNA shuffling techniques have yielded improved promoter variants with enhanced induction windows compared to wild-type .

  • 5'-UTR Optimization: Modifying the 5'-untranslated mRNA region derived from Pm transcripts can significantly impact translation efficiency. Selected mutations can be combined to create expression cassettes with substantially improved induction characteristics .

  • Induction Parameters: The system responds to benzoic acid derivatives as inducers, allowing fine-tuned expression control. Optimal inducer concentration and induction timing should be determined empirically for psaL production.

  • Selection Strategy: Using a bla gene (encoding β-lactamase) under Pm control allows direct selection of high-expressing mutants on ampicillin-containing media, as ampicillin tolerance correlates with expression levels .

What are the challenges in maintaining structural integrity of recombinant psaL during purification?

Maintaining the structural integrity of recombinant psaL presents several challenges due to its membrane protein nature:

  • Proper Folding: As a membrane protein component, psaL contains hydrophobic regions that may cause aggregation when expressed in E. coli. Strategies to address this include:

    • Expression at lower temperatures (16-25°C)

    • Co-expression with molecular chaperones

    • Use of specialized E. coli strains designed for membrane protein expression

  • Detergent Selection: Appropriate detergents are crucial for solubilizing psaL without denaturing it. A systematic screening of detergents should be performed to identify optimal conditions.

  • Buffer Composition: The recommended storage buffer contains Tris/PBS with 6% trehalose at pH 8.0, which helps maintain protein stability . The addition of glycerol (5-50%) for long-term storage at -20°C/-80°C prevents freeze-damage.

  • Quality Control: Purity assessment via SDS-PAGE (>90% purity) and functional assays should be conducted to ensure the recombinant protein retains native-like properties .

How can genome integration approaches improve consistent expression of psaL in cyanobacterial hosts?

For researchers seeking stable, long-term expression of psaL in cyanobacterial hosts like Synechococcus elongatus, genome integration offers significant advantages over plasmid-based expression. The Standardized Genome Architecture (SEGA) methodology provides an efficient approach:

  • Integration Strategy: Rather than relying on plasmid-based expression, direct genome integration of psaL expression cassettes ensures stable inheritance without antibiotic selection pressure. This approach requires only two reagents: a DNA fragment (commercially synthesizable) and bacterial cells, followed by incubation on agar plates .

  • Site-Specific Integration: For S. elongatus, specific genomic loci such as Synpcc7942_0741 (Phage tail protein I gene) have been successfully used for integration. Confirmation of integration can be performed by PCR amplification of the junction region between the genomic locus and the inserted construct .

  • Expression Control Systems: A T7 RNA polymerase-based expression system has been developed for S. elongatus, allowing inducible expression of heterologous genes. This system involves:

    • Integration of T7 RNA polymerase into the cyanobacterial genome under an inducible promoter

    • Cloning the psaL gene downstream of the T7 promoter (PT7)

    • Inducing expression only when desired, providing temporal control

  • CO2 Utilization Efficiency: Recombinant protein production in cyanobacteria can convert more than 50% of atmospheric CO2 into biomass, making this system environmentally beneficial compared to heterotrophic expression systems .

What quality control methods should be applied to verify recombinant psaL integrity?

A systematic quality control pipeline for recombinant psaL should include:

  • Purity Assessment:

    • SDS-PAGE analysis to confirm >90% purity

    • Size exclusion chromatography to verify homogeneity

    • Western blotting using anti-His antibodies or psaL-specific antibodies

  • Structural Integrity:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Thermal shift assays to determine protein stability

    • Limited proteolysis to evaluate folding quality

  • Functional Assessment:

    • Binding assays with other PSI subunits

    • Reconstitution experiments with PSI components

    • Spectroscopic analyses to verify pigment binding capability

  • Data Validation Protocols:

    • Apply spike tests to identify outliers in spectroscopic data, flagging readings that exceed established thresholds (similar to the methodology used in other scientific data quality control)

    • Implement reversal tests to detect anomalous patterns in data collection

    • Check for "stuck values" that might indicate instrument calibration issues

How can recombinant psaL be incorporated into artificial photosynthetic systems?

Incorporating recombinant psaL into artificial photosynthetic systems requires careful consideration of several factors:

  • Co-reconstitution with Other PSI Components:

    • Sequential addition of PSI subunits in appropriate ratios

    • Incorporation of essential cofactors (chlorophylls, carotenoids, iron-sulfur clusters)

    • Monitoring assembly using spectroscopic techniques

  • Membrane Scaffold Selection:

    • Nanodiscs with optimized lipid composition

    • Liposomes with controlled size and membrane properties

    • Polymer-based artificial membranes with tunable properties

  • Functional Coupling:

    • Integration with electron donors (artificial or natural plastocyanin)

    • Connection to electron acceptors (ferredoxin or synthetic alternatives)

    • Measuring electron transfer efficiency using spectroelectrochemical methods

  • Performance Evaluation:

    • Quantum yield determination under various light conditions

    • Long-term stability assessment

    • Comparison with native PSI complexes for benchmarking

The incorporation of recombinant psaL must preserve its role in organizing the PSI complex structure, which is critical for maintaining the precise spatial arrangement necessary for the complex's nearly 100% quantum efficiency in light utilization for electron transport .

What are the optimal conditions for analyzing psaL-protein interactions?

Analyzing psaL interactions with other proteins requires specialized approaches:

  • In Vitro Interaction Analysis:

    MethodApplicationAdvantagesLimitations
    Pull-down assaysVerification of direct bindingSimple, quantifiableMay miss weak interactions
    Surface Plasmon ResonanceKinetic parametersReal-time, label-freeRequires protein immobilization
    Isothermal Titration CalorimetryThermodynamic parametersNo immobilization neededRequires larger protein amounts
    Cross-linking Mass SpectrometryInteraction interfacesIdentifies contact pointsChemical modification required
  • In Vivo Interaction Studies:

    • Bacterial two-hybrid systems

    • Förster resonance energy transfer (FRET) with fluorescently tagged proteins

    • Co-immunoprecipitation followed by mass spectrometry

  • Computational Prediction:

    • Molecular docking simulations

    • Molecular dynamics to assess stability of predicted complexes

    • Sequence-based interaction prediction algorithms

  • Experimental Conditions Optimization:

    • Buffer composition (ionic strength, pH, specific ions)

    • Temperature ranges (4-37°C)

    • Detergent/lipid environment for membrane protein interactions

How should researchers interpret contradictory results in psaL functional studies?

When faced with contradictory results in psaL functional studies, researchers should implement a systematic analytical approach:

  • Methodological Comparison:

    • Evaluate differences in protein preparation (expression system, purification method)

    • Assess variation in experimental conditions (buffer composition, temperature, pH)

    • Consider the sensitivity and limitations of different analytical techniques

  • Quality Control Review:

    • Implement standardized quality assessments similar to those used in other scientific fields

    • Apply "stuck value" tests to identify potential instrument calibration issues

    • Use "density inversion" principles to identify physically impossible results

  • Protein Variant Analysis:

    • Verify the exact amino acid sequence used in different studies

    • Consider post-translational modifications or experimental artifacts

    • Assess the impact of affinity tags on protein function

  • Contextual Differences:

    • Evaluate the influence of different lipid environments

    • Consider interactions with other PSI components that may be present/absent

    • Assess the impact of different light conditions or redox environments

When documenting research findings, maintain detailed records of all experimental parameters to facilitate troubleshooting and ensure reproducibility.

What strategies can overcome low expression yields of recombinant psaL?

Researchers encountering low expression yields of recombinant psaL can implement several optimization strategies:

  • Expression System Optimization:

    • Test alternative E. coli strains specialized for membrane proteins

    • Consider cyanobacterial expression hosts like Synechococcus elongatus for native-like conditions

    • Implement the XylS/Pm expression system with optimized promoter variants

  • Genetic Construct Design:

    • Optimize codon usage for the expression host

    • Modify the 5'-UTR region to enhance translation efficiency

    • Test different fusion partners that can increase solubility

  • Cultivation Parameters:

    • Adjust induction conditions (inducer concentration, induction timing)

    • Optimize temperature, aeration, and media composition

    • Implement fed-batch or continuous cultivation strategies

  • Integrated Genomic Approach:

    • For cyanobacterial expression, implement genome integration using the SEGA methodology

    • Target neutral genomic sites for stable expression

    • Use the T7 RNA polymerase-based system for controlled expression

The selection of high-expressing variants can be facilitated using antibiotic resistance markers like the bla gene under control of the same promoter, allowing direct selection based on ampicillin tolerance levels .

How might psaL engineering contribute to improved photosynthetic efficiency?

Engineering psaL offers several promising approaches for enhancing photosynthetic efficiency:

  • Structural Modifications:

    • Targeted amino acid substitutions to optimize pigment orientation

    • Engineering stronger interactions with adjacent subunits for enhanced stability

    • Modifications to improve energy transfer pathways

  • Environmental Adaptations:

    • Engineering variants with improved thermostability

    • Developing salt-tolerant variants for diverse environmental applications

    • Creating variants with enhanced resistance to photoinhibition

  • Integration with Artificial Systems:

    • Designing attachment points for artificial light-harvesting complexes

    • Creating variants compatible with non-native electron donors/acceptors

    • Developing minimalist versions retaining core functionality

  • Synthetic Biology Applications:

    • Incorporation of psaL into standardized genome architectures like SEGA

    • Development of modular photosynthetic components for synthetic organisms

    • Creation of hybrid systems combining features from different photosynthetic organisms

These engineering approaches must be guided by the detailed structural understanding of PSI, recognizing that the precise spatial arrangement of protein subunits and cofactors is essential for maintaining the complex's remarkable quantum efficiency approaching 100% .

What are the implications of psaL research for developing biofuels and sustainable technologies?

Research on psaL and Photosystem I has significant implications for sustainable technologies:

  • Biofuel Production:

    • Engineered cyanobacteria expressing optimized psaL can enhance light capture efficiency

    • Improved PSI can increase reducing power (NADPH) generation for biofuel synthesis

    • Integration with CO2 fixation pathways can create carbon-neutral fuel production systems

  • CO2 Sequestration:

    • Recombinant protein production in cyanobacteria can convert more than 50% of atmospheric CO2 into biomass

    • Engineered photosynthetic systems incorporating optimized psaL could enhance carbon fixation

    • Integration with industrial processes could capture emissions from 1G ethanol production

  • Bioelectronic Applications:

    • PSI with engineered psaL could be incorporated into bio-photovoltaic devices

    • Bio-hybrid systems could generate hydrogen as a clean energy carrier

    • Photocatalytic systems could drive valuable chemical transformations

  • Environmental Remediation:

    • Photosynthetic bioreactors expressing recombinant proteins could treat wastewater

    • Systems could be designed to remove specific contaminants while generating biomass

    • Integration with existing industrial processes could reduce environmental impacts

The application of standardized genome architecture approaches like SEGA and expression systems like XylS/Pm will be crucial for developing reliable and scalable photosynthetic systems for these applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.