Recombinant Synechococcus sp. Photosystem Q (B) protein 1 (psbA1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order for preferential development.
Synonyms
psbA1; sync_0368; psbA4; sync_2384; Photosystem II protein D1 1; PSII D1 protein 1; Photosystem II Q(B protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Synechococcus sp. (strain CC9311)
Target Names
psbA1
Target Protein Sequence
MTTTIQQRSGANGWQQFCDWVTSTNNRLYVGWFGVLMIPTLLAATTCFIVAFIAAPPVDI DGIREPVAGSLMYGNNIISGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPFQLVVFHFL IGIYAYMGREWELSYRLGMRPWICVAYSAPVAAASAVFLVYPFGQGSFSDAMPLGISGTF NYMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTETESQNYGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGVSTMAFNLNGF NFNQSILDGQGRVLNTWADVLNRAGLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient for subsequent ATP production. PSII comprises a core antenna complex for photon capture and an electron transfer chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several downstream electron acceptors.
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the basic function of psbA1 in cyanobacterial photosystems?

The psbA1 gene encodes one variant of the D1 protein, a critical photosystem II (PSII) reaction center protein in cyanobacteria. In species like Synechococcus elongatus PCC 7942, psbA1 is part of a three-member gene family (psbA1, psbA2, psbA3) that collectively manage the production of D1 proteins. The D1 protein functions as a core component of PSII, playing a crucial role in the photosynthetic electron transport chain, particularly in the water-splitting reactions and electron transfer to plastoquinone.

The regulation of these genes is complex and occurs at both transcriptional and posttranscriptional levels, resulting in an interchange of different D1 protein forms in the membrane in response to environmental conditions. This versatility allows cyanobacteria to optimize photosynthetic efficiency across varying light environments.

How does psbA1 expression differ from other psbA genes under varying light conditions?

Unlike other members of the psbA family, psbA1 expression is distinctly downregulated under high-intensity light conditions, while psbA2 and psbA3 are induced. This differential regulation occurs through two primary mechanisms:

  • Transcriptional regulation: Under high light, psbA1 promoter activity decreases, limiting new transcript production.

  • Posttranscriptional regulation: Accelerated degradation of psbA1 mRNA occurs under high light conditions.

The PsbA1 variant is generally considered "low-light-adapted" compared to the "high-light-adapted" PsbA3, suggesting an evolutionary specialization that allows cyanobacteria to thrive across diverse light environments. This specialization may represent a unique cyanobacterial adaptation, as plants and algae naturally contain only the high-light-adapted PsbA-variant proteins.

What structural differences exist between PsbA1 and other PsbA variants?

The PsbA1 and PsbA3 proteins display 21 amino acid differences in their sequences. These variations are not randomly distributed but occur at positions crucial for protein function. Key differences include:

PositionPsbA1PsbA3Functional Impact
130GlnGluAffects stabilization of PheoD1 anion radical; increases midpoint potential by ~17 mV in PsbA3
153SerAlaContributes to structural differences in electron transfer chain
270SerAlaAffects interactions with surrounding protein environment

The Gln to Glu exchange at position 130 has received particular attention as it stabilizes the PheoD1 anion radical, resulting in an increase in the midpoint potential from -522 mV in PsbA1-PSII to -505 mV in PsbA3-PSII.

What are the most effective methods for expressing recombinant psbA1 in heterologous systems?

For successful recombinant expression of psbA1, researchers should consider these methodological approaches:

  • Promoter selection: While the native psbA1 promoter has complex regulatory elements, using stronger constitutive promoters like the lambda-phage pR promoter can enhance expression. The choice between native regulatable promoters (like cpc phycocyanin promoter) or constitutive promoters depends on your experimental goals.

  • Expression system optimization: For heterologous expression, two main approaches have proven successful:

    • Chromosomal integration: Inserting the gene into a neutral chromosomal site ensures stable inheritance but may yield lower expression levels.

    • Replicative plasmid systems: Using RSF1010-derived vectors can provide higher copy numbers but may impose metabolic burden on the host.

  • Codon optimization: Adapting the psbA1 codons to match the host's codon usage bias significantly improves expression efficiency, particularly for cross-kingdom expression (e.g., plant genes in bacteria).

Studies comparing these approaches found that chromosomal integration with native promoters can produce more stable long-term expression, while plasmid-based systems with strong promoters may yield higher initial expression levels but show less stability over extended cultivation periods.

What techniques are most reliable for measuring psbA1 gene expression and protein activity?

Several complementary techniques provide robust analysis of psbA1 expression and function:

  • Transcriptional analysis:

    • Reporter gene fusions: psbA1::lacZ and psbA1::luxAB constructs allow real-time monitoring of promoter activity under varying conditions. The luminescence-based luxAB system is particularly useful for continuous monitoring in living cultures.

    • RT-qPCR: Quantifies transcript levels with high sensitivity, essential for detecting the rapid degradation of psbA1 mRNA under high light.

  • Protein analysis:

    • Western blotting: Using D1-specific antibodies to quantify protein levels.

    • Mass spectrometry: Enables precise identification of the expressed D1 variant and post-translational modifications.

  • Functional assessment:

    • Oxygen evolution measurements: Directly quantifies PSII activity.

    • Electron transfer kinetics: Using spectroscopic techniques to measure electron transfer rates.

    • Redox polymer/protein biophotoelectrochemistry: This technique embeds isolated PSII complexes in a redox hydrogel, allowing diffusion-free electron transfer to an electrode surface and direct measurement of photocurrent response. This approach has revealed that electrodes with PsbA1-PSII can generate photocurrent densities up to 2-fold higher than those with PsbA3-PSII under various light conditions.

How can I activate the normally silent psbA1 gene in Synechocystis species?

The psbA1 gene in Synechocystis sp. strain 6803 is naturally silent despite being part of the three-member psbA gene family. To activate this gene, researchers have successfully employed upstream regulatory sequence exchange:

  • Promoter replacement strategy: Exchange part of the psbA1 upstream region with the corresponding fragment from psbA2. This approach has demonstrated that the psbA2 segment contains all necessary regulatory elements for both light-dependent expression and high-light-stimulated transcription.

  • Implementation protocol:

    • Create a construct containing the psbA2 upstream regulatory region fused to the psbA1 coding sequence

    • Introduce this construct via homologous recombination

    • Select transformants and confirm activation through RT-PCR or reporter gene expression

This technique not only activates the previously silent gene but also maintains the light-regulated expression pattern characteristic of active psbA genes. Interestingly, strains containing only the activated psbA1 as their sole functional psbA gene can grow photoautotrophically at rates comparable to wild type, demonstrating that despite its divergent sequence, the D1' protein produced by psbA1 can functionally substitute for the standard D1 in PSII complexes under laboratory conditions.

How does the presence of specific upstream elements affect psbA1 transcriptional regulation?

The regulation of psbA1 involves complex interactions between multiple upstream elements and cellular factors. Unlike other psbA genes, psbA1 requires additional sequences upstream of the -35 element for expression. Research has identified several key regulatory features:

These findings indicate that while promoter strength can be modulated through sequence modifications, the light-responsive regulation involves a more complex interplay of cis-elements and trans-acting factors beyond the core promoter region.

What mechanisms underlie the differential stability of PsbA1 versus PsbA3 under photoinhibitory conditions?

The differential stability of PsbA1 and PsbA3 under high light conditions involves both structural and functional factors:

  • Electron transfer properties: The Q130E substitution in PsbA3 (versus PsbA1) increases the midpoint potential of PheoD1 by approximately 17mV (from -522mV to -505mV). This alteration affects the equilibrium between QA- and PheoD1-, potentially reducing charge recombination events that produce damaging triplet chlorophyll states.

  • Interaction with QB site quinones: The energetics of the exchangeable quinone (QB) plays a crucial role in photoinhibition resistance. Different D1 variants show altered binding properties and redox potentials for plastoquinones at the QB site, affecting electron transfer efficiency and susceptibility to photodamage.

  • Repair cycle efficiency:

    ParameterPsbA1-PSIIPsbA3-PSII
    Damage rate under high lightHigherLower
    D1 turnover rateLowerHigher
    Photosynthetic efficiency after prolonged high lightReducedMaintained

The enhanced stability of PsbA3 under high light reflects an evolutionary adaptation that prioritizes robustness over the quantum efficiency advantages that PsbA1 may provide under low light conditions.

How can biophotoelectrochemical approaches reveal functional differences between PsbA variants?

Biophotoelectrochemistry provides powerful tools for studying the electron transfer properties of different PsbA variants:

  • Electrochemical setup advantages: Modern redox polymer/protein biophotoelectrochemical approaches allow diffusion-free electron transfer from PSII (with either PsbA1 or PsbA3) via redox-active hydrogels toward an electrode. This enables immediate photocurrent response measurements and direct comparison of electron transfer efficiencies.

  • Performance comparison: Electrodes modified with PsbA1-PSII generate initial photocurrent densities up to 2-fold higher than those with PsbA3-PSII across various light conditions. This difference is most pronounced under conditions mimicking natural low light environments, supporting the hypothesis that PsbA1 is optimized for low light intensity photosynthetic efficiency.

  • Experimental design consideration:

    • Protein immobilization must preserve native structure and function

    • Light intensity should be carefully controlled to isolate variant-specific responses

    • Electrode materials and redox polymers must be compatible with biological systems

These approaches reveal that while PsbA3 offers enhanced stability under stress conditions, PsbA1 provides superior quantum efficiency under optimal conditions—information that would be difficult to obtain using traditional biochemical approaches alone.

How can comparative studies between psbA variants inform evolutionary adaptations in photosynthetic organisms?

Comparative analysis of psbA variants provides significant insights into photosynthetic evolution:

  • Cyanobacterial specialization: The existence of both low-light (PsbA1) and high-light (PsbA3) adapted variants in cyanobacteria represents a specialized adaptation. Interestingly, plants and algae naturally contain only the high-light-adapted PsbA3-like variant, suggesting that PsbA1 may be a specific cyanobacterial feature enabling growth under very low light intensities.

  • Cross-species transfer experiments: When the cyanobacterial D1 copies PsbA1 and PsbA3 were recombinantly expressed in the green algae Chlamydomonas reinhardtii, the strain with the low-light-adapted PsbA1 variant accumulated 12% more biomass under low-light conditions compared to the strain with the high-light-adapted PsbA3 copy. This demonstrates the functional significance of these variants across diverse photosynthetic lineages.

  • Evolutionary pressure balance: The maintenance of multiple psbA variants in cyanobacteria reflects balanced selection pressures that favor efficiency under optimal conditions versus robustness under stress conditions—a trade-off that has been resolved differently across the photosynthetic lineage.

These findings suggest that the diversity of psbA genes represents an important adaptive mechanism that allows cyanobacteria to thrive across a wider range of light environments than organisms with more specialized photosynthetic machinery.

What methodological challenges exist when expressing multiple psbA variants in heterologous systems?

Researchers face several technical challenges when working with multiple psbA variants in heterologous expression systems:

  • Promoter selection and regulation: Different psbA genes have evolved with distinct regulatory mechanisms. When expressing these genes in heterologous systems, choosing between native promoters that maintain differential regulation versus constitutive promoters that maximize expression represents a key decision point.

    Promoter TypeExamplesAdvantagesLimitations
    Native psbA promoterspsbA2 promoterMaintains natural regulationLower expression
    Constitutive bacterialLambda-phage pRHigher expressionLoss of differential regulation
    Other cyanobacterialcpc phycocyaninIntermediate regulationVariable performance
  • Expression platform considerations: Researchers must choose between:

    • Chromosomal integration: More stable but lower expression

    • Replicative plasmids: Higher copy number but potential instability

    • Different expression hosts: E. coli (easier manipulation) vs. cyanobacteria (authentic processing)

  • Verification challenges: Confirming the identity and functionality of expressed PsbA variants requires:

    • Specific antibodies that can distinguish between highly similar protein variants

    • Methods to isolate and reconstitute PSII complexes with the desired D1 variant

    • Functional assays that can detect subtle differences in electron transfer properties

Addressing these challenges requires a multi-faceted approach combining molecular biology techniques with sophisticated biophysical measurements to ensure both expression and functional characterization of the different psbA variants.

How do the unique properties of PsbA1 and PsbA3 inform strategies for engineering enhanced photosynthetic efficiency?

The natural variations between PsbA1 and PsbA3 provide valuable design principles for photosynthetic engineering:

  • Environmental optimization strategy: The distinct properties of PsbA variants suggest a potential engineering approach where photosynthetic organisms could be designed with switchable or environment-specific D1 proteins to optimize performance across varying conditions. For example, a strain containing PsbA1 accumulated 12% more biomass under low-light conditions compared to a strain with PsbA3, demonstrating tangible productivity gains through appropriate variant selection.

  • Site-directed mutagenesis targets: Specific amino acid differences between PsbA1 and PsbA3, particularly the Q130E substitution that affects PheoD1 midpoint potential, represent high-value targets for site-directed mutagenesis to fine-tune electron transfer properties. This approach allows researchers to create customized D1 variants with optimized properties for specific applications.

  • Biomimetic design principles: The natural engineering of different PsbA variants provides valuable insights for developing artificial photosynthetic systems. The biophotoelectrochemical findings showing higher initial photocurrent density with PsbA1-PSII under various light conditions suggest that mimicking these natural optimizations could enhance the efficiency of bio-hybrid photovoltaic systems.

By understanding and applying the molecular basis for the functional differences between natural PsbA variants, researchers can develop targeted strategies to enhance photosynthetic efficiency in both natural and artificial systems.

Why might recombinant psbA1 expression levels be lower than expected in my system?

Several factors could contribute to lower-than-expected psbA1 expression levels:

  • Promoter compatibility issues: The psbA1 gene requires specific upstream elements for proper expression. If your construct lacks these elements or uses an incompatible promoter, expression may be compromised. The psbA1 promoter contains an atypical -10 element (TCTCCT) that affects expression strength.

  • Regulatory interference: The untranslated leader sequence of the psbA1 transcript binds regulatory proteins that affect expression. If these binding sites are altered or if the host lacks compatible regulatory factors, expression may be affected.

  • Sigma factor interactions: psbA1 expression is influenced by group 2 sigma factors. In hosts with different sigma factor profiles, expression patterns may deviate from expectations.

  • Technical approaches to diagnose and resolve:

    • Compare expression using different promoters (native vs. constitutive)

    • Test both chromosomal integration and plasmid-based expression

    • Use reporter gene fusions (psbA1::lacZ or psbA1::luxAB) to quantify promoter activity

    • Consider mutagenizing the atypical psbA1 -10 element to the consensus TATAAT sequence, which has been shown to increase expression magnitude

How can I differentiate between native and recombinant PsbA proteins in my experimental system?

Distinguishing between native and recombinant PsbA proteins requires strategic approaches:

  • Epitope tagging:

    • Add a small epitope tag (His, FLAG, etc.) to the recombinant protein

    • Ensure the tag doesn't interfere with function through control experiments

    • Use tag-specific antibodies for Western blot analysis

  • Amino acid substitutions as markers:

    • Introduce silent mutations that create unique restriction sites in the recombinant gene

    • Consider using the natural differences between PsbA variants (e.g., Q130E) as distinguishing features

    • Develop PCR-based assays to differentiate between native and recombinant genes

  • Mass spectrometry approaches:

    • Digest isolated PSII complexes and analyze peptide fragments

    • Focus on regions with known sequence differences between variants

    • Quantify relative abundance of variant-specific peptides

  • Functional differentiation:

    • Use biophotoelectrochemical techniques that can detect the characteristic differences in electron transfer properties between PsbA variants

    • Measure photocurrent generation, which can be up to 2-fold higher with PsbA1-PSII compared to PsbA3-PSII

These approaches can be combined for robust identification of recombinant proteins in complex experimental systems.

What are the critical considerations when analyzing conflicting data about psbA1 function across different studies?

When reconciling conflicting results across studies on psbA1 function, consider these methodological factors:

  • Expression system variations:

    • Different studies use various promoters (lambda-phage pR, cpc phycocyanin, psbA) that affect expression patterns

    • Expression platform differences (chromosomal integration vs. replicative plasmids) impact expression levels

    • The observed bisabolene production levels from one study (~0.5 mg·L⁻¹ after 21 days) were lower than previously reported levels (~0.5 mg·L⁻¹ after six days) when using different promoters and integration methods

  • Measurement timing and conditions:

    • Some studies report measurements after short periods (4-7 days) while others track expression over longer timeframes

    • Light conditions, particularly intensity and cycling, significantly impact psbA1 regulation

    • The observed limonene production in one study (~0.06 mg·L⁻¹ after seven days) was lower than previously reported (~17 mg·L⁻¹ after seven days) due to differences in expression systems

  • Analytical framework:

    • Create a standardized comparison table normalizing results based on:

      • Expression system characteristics

      • Measurement conditions and timepoints

      • Host strain background

    • Identify methodological differences that could explain divergent results

    • Consider the possibility that different aspects of psbA1 function are being measured

  • Cross-validation approaches:

    • Replicate key experiments using standardized protocols

    • Combine multiple analytical techniques (genetic, biochemical, biophysical) to build a more complete picture

    • Focus on core functional properties rather than absolute quantitative values that are highly system-dependent

By systematically analyzing methodological differences, researchers can often reconcile apparently conflicting data into a more coherent understanding of psbA1 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.