Recombinant Synechococcus sp. Photosystem Q (B) protein 2

Shipped with Ice Packs
In Stock

Description

Table 1: Comparative Features of Recombinant PsbA2 Variants

FeatureVariant 1 ( )Variant 2 ( )
UniProt IDQ7U669Q2JTT0
Amino Acid Length343 residues348 residues
Source OrganismSynechococcus sp. PCC7002Synechococcus sp. CC9311
Key Domains- Transmembrane helices- Plastoquinone-binding sites
- Mn-cluster coordination- Non-heme Fe(II) ligation
Purity>90% (SDS-PAGE)>90% (SDS-PAGE)

The protein contains conserved motifs critical for PSII assembly, including:

  • Q_B-binding pocket: Facilitates plastoquinone exchange and electron transfer .

  • D1 degradation signals: Recognized by proteases under photoinhibitory conditions .

Functional Insights

PsbA2 plays a dual role in PSII:

Electron Transfer Dynamics

  • Binds plastoquinone Q_B, enabling electron transfer from Q_A to the plastoquinone pool .

  • Cold stress induces a PsbA2 isoform (D1:2) that lowers Q_B’s redox potential, enhancing charge recombination for photoprotection .

Photodamage and Repair

  • Under high light or low temperature, PsbA2 undergoes site-specific degradation by FtsH proteases, followed by replacement with PsbA1 (D1:1) .

  • Structural studies show PsbA2-PSII exhibits altered herbicide-binding affinity due to residue substitutions near the Q_B site (e.g., Phe255→Ser) .

Research Applications

Recombinant PsbA2 is pivotal for:

Biotechnological Tools

  • ELISA kits: Commercial products (e.g., Creative BioMart catalog RFL20384SF) utilize recombinant PsbA2 for antibody validation .

  • Mutagenesis platforms: Study the impact of residues like Glu241 on PSII assembly and photoinhibition .

Table 2: Recombinant PsbA2 Production Protocols

ParameterDetails ( )
Expression HostE. coli
Storage BufferTris/PBS with 6% trehalose (pH 8.0)
ReconstitutionLyophilized powder → 0.1–1.0 mg/mL in sterile water (+50% glycerol for long-term storage)
Stability-20°C/-80°C (avoid freeze-thaw cycles)

Challenges and Future Directions

  • Functional redundancy: Multiple PsbA isoforms complicate in vivo studies of PsbA2-specific roles .

  • Engineering applications: Modifying PsbA2’s Q_B-binding site could enhance photosynthetic efficiency in crops .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be established during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
psbA2; SynRCC307_1441; Photosystem II protein D1 2; PSII D1 protein 2; Photosystem II Q(B protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Synechococcus sp. (strain RCC307)
Target Names
psbA2
Target Protein Sequence
MSTAVRSGRVSSWESFCQWVTNTDNRIYVGWFGVLMIPCLLAATICYIIAFIAAPPVDID GIREPVAGSFLYGNNIISGAVIPSSNAIGLHFYPIWEAATLDEWLYNGGPYQLVVFHFLI GISAYMGRQWELSYRLGMRPWICVAYAAPLSAAMVVFLIYPFGQGSFSDGMPLGISGTFN FMLVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLVRETTESESQNYGYKFGQ EEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTSMGIATMAFNLNGFN FNQSILDAQGKVVPTWADVLNRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H(2)O, generating O(2) and a proton gradient, which is subsequently used for ATP formation. It comprises a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, as well as several subsequent electron acceptors.
Database Links
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Cellular thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Photosystem Q(B) protein 2 in Synechococcus sp. and what is its function?

Photosystem Q(B) protein 2, also known as D1:2, is one of the forms of the D1 protein that constitutes the reaction center of Photosystem II in cyanobacteria. D1 is a critical component in the electron transport chain of photosynthesis. Specifically, the Q(B) site serves as the secondary electron acceptor in PSII, where plastoquinone is reduced during photosynthetic electron transport.

The D1:2 isoform (as opposed to D1:1) features distinctive redox properties that contribute to stress tolerance in Synechococcus sp. When cyanobacteria are exposed to environmental stressors such as low temperature or high light conditions, they can transiently exchange D1:1 for D1:2 in the PSII reaction center . This substitution alters the redox potential of Q(B), making it lower and closer to that of Q(A), which affects the charge equilibrium between these electron acceptors .

What is the physiological significance of the D1:1 to D1:2 exchange in Synechococcus sp.?

The transient exchange of D1:1 for D1:2 in Synechococcus sp. represents an important adaptive mechanism that helps these cyanobacteria cope with environmental stress. When cells are exposed to low temperatures under constant light conditions, they switch from D1:1 to D1:2, though this change is temporary. After acclimation to the lower temperature, cells revert to using D1:1, which appears to be the preferred form in fully acclimated cells .

This exchange serves as a protective mechanism against photodamage during periods of excessive excitation. By lowering the redox potential of Q(B) through the incorporation of D1:2, the charge equilibrium between Q(A) and Q(B) shifts in favor of Q(A). This increases the probability of Q(A)- and P680+ recombination, resulting in non-radiative energy dissipation within the PSII reaction center . This mechanism is particularly important for cyanobacteria, which lack the antenna and zeaxanthin cycle-dependent quenching mechanisms found in higher plants .

What are the most effective methods for expressing and purifying recombinant Synechococcus sp. Photosystem Q(B) protein 2?

Expressing and purifying recombinant Synechococcus sp. Photosystem Q(B) protein 2 requires specialized techniques due to its membrane-bound nature. A successful methodology involves:

  • Genetic Cloning and Vector Construction:

    • Amplify the target gene (psbA2) using PCR with specific primers

    • Create shuttle expression vectors with appropriate promoters (such as PpsbA) and antibiotic resistance markers

    • Incorporate fusion tags to facilitate detection and purification

  • Transformation into Host Organisms:

    • For cyanobacterial expression, tri-parental conjugative transfer can be used to transform Synechococcus

    • Mix E. coli harboring the shuttle expression plasmid with fresh cyanobacterial cells

    • Screen transformants on selective media containing appropriate antibiotics (e.g., kanamycin)

  • Verification of Expression:

    • Confirm successful transformation using PCR detection of the target gene

    • Analyze protein expression using Western blotting or fluorescent reporters if fusion proteins are used

  • Purification Strategies:

    • Isolate thylakoid membranes through cell disruption and differential centrifugation

    • Solubilize membrane proteins using mild detergents

    • Utilize affinity chromatography based on incorporated tags

    • Perform size exclusion chromatography for final purification

For optimal storage of the purified protein, a Tris-based buffer with 50% glycerol is recommended, with storage at -20°C for short-term and -80°C for extended storage .

How can researchers determine the structural location of Photosystem Q(B) protein 2 within the PSII complex?

Determining the structural position of Photosystem Q(B) protein 2 within the PSII complex requires advanced structural biology techniques. While this specific protein is not visible in current crystal structures of PSII from thermophilic cyanobacteria, researchers can employ the following methodologies:

  • Chemical Cross-linking Coupled with Mass Spectrometry:

    • Isolate intact PSII complexes from Synechococcus sp.

    • Apply chemical cross-linkers to stabilize protein-protein interactions

    • Digest cross-linked complexes with proteases

    • Analyze cross-linked peptides using liquid chromatography/tandem mass spectrometry (LC-MS/MS)

    • Identify interaction partners and binding sites

  • Mutagenesis Studies:

    • Create site-directed mutations in key residues

    • Analyze the effects on complex assembly and function

    • Use biochemical assays to determine changes in protein interactions

  • Immunodetection:

    • Develop specific antibodies against Photosystem Q(B) protein 2

    • Use immunogold labeling combined with electron microscopy

    • Visualize the protein's location within the complex

Using these approaches, researchers can map interaction networks similar to how PsbQ's location was determined in Synechocystis sp. PCC 6803, where it was found to associate closely with PsbO and CP47 proteins .

What experimental systems are best suited for studying the effects of environmental stress on D1:1 to D1:2 exchange?

Investigating the environmental stress-induced exchange between D1:1 and D1:2 requires carefully controlled experimental systems:

  • Controlled Growth Chambers:

    • Culture Synechococcus sp. in photobioreactors with precise control over:

      • Temperature (20-28°C range is commonly used)

      • Light intensity (around 125 μmol quanta m−2 s−1)

      • Nutrient composition (various NO3−:PO43− ratios)

  • Mutant Strain Analysis:

    • Utilize inactivation mutants that possess only D1:1 (e.g., R2S2C3) or D1:2 (e.g., R2K1)

    • Compare responses to environmental stressors between these mutants

  • Thermoluminescence Measurements:

    • Monitor charge recombination events between acceptor and donor sides of PSII

    • Analyze differences in redox potentials of electron acceptors (Q(A) and Q(B))

    • Track changes in recombination patterns during stress responses

  • Time-Course Experiments:

    • Sample cultures at regular intervals during stress exposure and recovery

    • Quantify relative abundance of D1:1 versus D1:2 using proteomic approaches

    • Correlate protein exchange with physiological parameters and photosynthetic efficiency

For accurate simulation of natural conditions, continuous culture methods are preferred over batch cultures, as they allow for stable maintenance of defined growth conditions .

How can the ProSynTaxDB database be used to study Synechococcus sp. genomics and proteomics?

The ProSynTaxDB database provides a valuable resource for researchers studying Synechococcus sp. genomics and proteomics. This curated protein sequence database enhances taxonomic resolution for Prochlorococcus and Synechococcus classification, containing proteins from 1,260 genomes including single-amplified genomes, high-quality draft genomes, and closed genomes .

To effectively utilize ProSynTaxDB:

  • Taxonomic Classification:

    • Accurately identify picocyanobacterial clusters/clades/grades in metagenomic samples

    • Distinguish Synechococcus lineages even when present at low abundance (as low as 0.09% of reads)

  • Workflow Implementation:

    • Apply the accompanying workflow for quality control, taxonomic classification, and count normalization

    • Process short-read sequences to determine both absolute and normalized read abundances

    • Generate reports at user-defined taxonomic levels

  • Comparative Genomics:

    • Analyze core protein similarity between individual genomes

    • Investigate niche partitioning and ecological adaptation of different Synechococcus phylogenetic branches

    • Examine the evolution of photosystem components across strains

When analyzing proteins like Photosystem Q(B) protein 2, researchers can leverage this database to examine sequence conservation, phylogenetic relationships, and potential adaptations across different environmental contexts.

What techniques are most effective for investigating the redox properties of Q(B) in recombinant Synechococcus sp. PSII complexes?

Investigating the redox properties of Q(B) in recombinant Synechococcus sp. PSII complexes requires specialized biophysical and biochemical techniques:

  • Thermoluminescence Studies:

    • Measure light emission resulting from charge recombination between electron donors and acceptors

    • Analyze the temperature-dependent glow curves to determine energy gaps

    • Calculate the redox potential differences between Q(A) and Q(B)

    • Compare redox characteristics between D1:1 and D1:2-containing complexes

  • Chlorophyll Fluorescence Analysis:

    • Measure variable fluorescence parameters (Fv/Fm) to assess PSII efficiency

    • Perform fluorescence induction kinetics to examine electron transport rates

    • Analyze non-photochemical quenching as an indicator of energy dissipation

  • Electrochemical Measurements:

    • Use potentiometric titrations to directly measure redox potentials

    • Compare electron transfer rates between different PSII complexes

  • Oxygen Evolution Assays:

    • Measure oxygen production rates using oxygen electrodes

    • Assess the efficiency of water oxidation under various conditions

    • Determine the effects of different forms of D1 on oxygen evolution capacity

The following data table summarizes key differences observed between D1:1 and D1:2-containing PSII complexes:

ParameterD1:1-containing PSIID1:2-containing PSIIReference
Q(B) redox potentialHigherLower (closer to Q(A))
Q(A)/Q(B) charge equilibriumFavors Q(B)Favors Q(A)
Non-radiative energy dissipationLowerHigher
Cold stress resistanceLowerHigher
High light resistanceLowerHigher

How can researchers effectively analyze the role of PsbQ in relation to Photosystem Q(B) protein function?

To analyze the relationship between PsbQ and Photosystem Q(B) protein function, researchers can employ several complementary approaches:

  • Cross-linking Analysis Combined with Mass Spectrometry:

    • Isolate intact PSII complexes containing both PsbQ and D1 proteins

    • Apply cross-linking agents to stabilize protein-protein interactions

    • Identify cross-links between PsbQ and other PSII components

    • Map the three-dimensional arrangement of proteins within the complex

  • Genetic Manipulation Studies:

    • Create deletion mutants lacking PsbQ (ΔpsbQ)

    • Generate strains with modified D1:2 proteins

    • Examine the effects on PSII assembly, stability, and function

    • Analyze phenotypes under various environmental conditions

  • Functional Assays Under Nutrient Limitation:

    • Test PSII activity under Ca2+ and Cl- limiting conditions

    • Compare wild-type and mutant strains

    • Quantify oxygen evolution rates

    • Assess PSII stability over time

  • Structural Analysis of Protein Interactions:

    • Use in silico protein docking to predict interaction interfaces

    • Validate predictions through mutagenesis of key residues

    • Examine charge-pair interactions between proteins

Research has shown that PsbQ in cyanobacteria is closely associated with the PsbO and CP47 proteins, with specific cross-links detected between lysine 120 of PsbQ and lysines 180 and 59 of PsbO, as well as between lysine 102 of PsbQ and aspartic acid 440 of CP47 . These interactions suggest that PsbQ helps stabilize the PSII dimer by interacting with these proteins and reducing solvent exposure at the interaction interfaces .

What are the critical parameters for successfully transforming Synechococcus sp. with recombinant protein constructs?

Successfully transforming Synechococcus sp. with recombinant protein constructs requires careful attention to several critical parameters:

  • Vector Design Considerations:

    • Selection of appropriate promoters (PpsbA is commonly used for PSII proteins)

    • Inclusion of suitable antibiotic resistance markers (e.g., kanamycin resistance)

    • Proper fusion tags for detection and/or purification

    • Effective terminator regions

  • Transformation Methodology:

    • Tri-parental conjugative transfer is highly effective

    • Mix E. coli harboring the shuttle expression plasmid with helper plasmids (RP4 + pRL542)

    • Combine with fresh cyanobacterial cells in optimal physiological state

    • Culture on selective media with appropriate antibiotics

  • Optimization Parameters:

    • Cell density at time of transformation (typically mid-logarithmic phase)

    • Ratio of E. coli to cyanobacterial cells

    • Light intensity during recovery period

    • Temperature during conjugation and selection

  • Verification Strategies:

    • PCR confirmation of successful gene insertion

    • Expression analysis using Western blotting or fluorescent reporters

    • Functional assays to verify protein activity

When designing fusion constructs, careful consideration of linker sequences is important. For example, flexible linkers like GGGGS have been successfully used to connect proteins without disrupting their function .

How should researchers approach experimental design when studying temperature effects on D1:1/D1:2 exchange in Synechococcus sp.?

When investigating temperature effects on the D1:1/D1:2 exchange in Synechococcus sp., researchers should implement a comprehensive experimental design approach:

  • Growth Condition Matrix:

    • Temperatures: Test multiple temperatures (e.g., 20°C, 24°C, 28°C) to capture the transition range

    • Light Intensities: Maintain consistent light (e.g., 125 μmol quanta m−2 s−1) or test multiple intensities

    • Nutrient Conditions: Control macronutrient ratios (e.g., NO3−:PO43− ratios of 1.7 and 80)

    • Growth Method: Use continuous culture methods with slow dilution rates for stable conditions

  • Time Course Analysis:

    • Begin with fully acclimated cultures (containing predominantly D1:1)

    • Apply temperature shift treatments

    • Collect samples at regular intervals (e.g., 0, 6, 12, 24, 48, 72 hours)

    • Continue sampling through acclimation period until return to D1:1 dominance

  • Analytical Approaches:

    • Protein Analysis: Quantify D1:1/D1:2 ratio using proteomic techniques

    • Thermoluminescence: Monitor changes in Q(B) redox properties

    • Chlorophyll Fluorescence: Track photosynthetic efficiency

    • Gene Expression: Analyze transcription of psbA genes encoding D1 variants

  • Control Experiments:

    • Use inactivation mutants with only D1:1 (R2S2C3) or D1:2 (R2K1) as references

    • Include non-stressed control cultures maintained at constant temperature

    • Test recovery by returning stressed cultures to original conditions

A critical aspect of this experimental design is ensuring balanced growth conditions that mimic natural environments while allowing for controlled manipulation of specific variables. Using artificial seawater with defined composition helps maintain reproducibility across experiments .

What are the key challenges in structural studies of membrane-bound photosystem proteins and how can they be overcome?

Structural studies of membrane-bound photosystem proteins like Synechococcus sp. Photosystem Q(B) protein 2 present several significant challenges:

  • Protein Extraction and Solubilization Challenges:

    • Problem: Membrane proteins are difficult to extract in their native conformation

    • Solution:

      • Use mild detergents optimized for photosystem proteins

      • Employ native nanodiscs or styrene maleic acid lipid particles (SMALPs)

      • Carefully control solubilization conditions (temperature, pH, ionic strength)

  • Protein Complex Stability Issues:

    • Problem: PSII complexes may dissociate during purification

    • Solution:

      • Apply chemical cross-linking to stabilize protein-protein interactions

      • Use gentle purification procedures with minimal processing steps

      • Include stabilizing agents like glycerol in buffers

  • Crystallization Difficulties:

    • Problem: Membrane proteins are notoriously difficult to crystallize

    • Solution:

      • Explore lipidic cubic phase crystallization

      • Apply surface entropy reduction through targeted mutations

      • Screen extensive crystallization conditions with various detergents

  • Protein Dynamics and Heterogeneity:

    • Problem: Some components like PsbQ are absent in crystal structures

    • Solution:

      • Combine complementary structural techniques (X-ray crystallography, cryo-EM, cross-linking MS)

      • Use computational modeling to integrate diverse structural data

      • Apply in situ structural techniques that capture native environments

  • Functional Validation:

    • Problem: Structural data may not reflect physiologically relevant states

    • Solution:

      • Correlate structural findings with functional assays

      • Perform site-directed mutagenesis to verify important structural features

      • Use time-resolved structural methods to capture different functional states

By implementing these strategies, researchers have successfully determined cross-links between PsbQ and other PSII components in Synechocystis sp. PCC 6803, revealing its location near the water oxidation site on the lumenal side of the complex .

What are the emerging technologies that could advance our understanding of Synechococcus sp. Photosystem Q(B) protein function?

Several cutting-edge technologies are poised to transform our understanding of Synechococcus sp. Photosystem Q(B) protein function:

  • Cryo-Electron Tomography:

    • Visualize intact PSII complexes in their native membrane environment

    • Capture dynamic structural changes during D1:1/D1:2 exchange

    • Resolve the three-dimensional arrangement of proteins within thylakoid membranes

  • Time-Resolved Serial Femtosecond Crystallography:

    • Use X-ray free-electron lasers to capture ultrafast electron transfer events

    • Visualize structural changes during the photosynthetic reaction in real-time

    • Determine how D1 variants affect electron transport kinetics

  • Single-Molecule Fluorescence Resonance Energy Transfer (smFRET):

    • Track conformational changes in individual protein complexes

    • Observe the dynamics of D1:1/D1:2 exchange at the single-molecule level

    • Measure distances between key residues during photosynthetic reactions

  • CRISPR-Cas9 Genome Editing in Cyanobacteria:

    • Create precise modifications to the psbA genes

    • Generate libraries of D1 variants with specific mutations

    • Study structure-function relationships with unprecedented precision

  • Integrative Multi-omics Approaches:

    • Combine proteomics, transcriptomics, and metabolomics data

    • Use resources like ProSynTaxDB to analyze strain-specific adaptations

    • Build comprehensive models of photosystem regulation under environmental stress

These technologies will help address fundamental questions about how the D1:1/D1:2 exchange mechanism evolved and its role in cyanobacterial adaptation to changing environments.

How might climate change impact the D1:1/D1:2 exchange mechanism in natural Synechococcus populations?

The impact of climate change on the D1:1/D1:2 exchange mechanism in natural Synechococcus populations represents an important area for future research:

  • Temperature Effects:

    • Rising ocean temperatures may alter the threshold for triggering D1:1/D1:2 exchange

    • Changes in the frequency and duration of cold stress events could affect the utility of this adaptation

    • Thermal acclimation capacity may vary among different Synechococcus clades

  • Light Intensity Interactions:

    • Increased stratification may expose surface populations to higher light intensities

    • Combined effects of temperature and light stress could alter the dynamics of D1 protein exchange

    • Cloud cover changes may create more variable light environments requiring rapid photosystem adjustments

  • Nutrient Availability Interactions:

    • Altered nutrient regimes (e.g., changing NO3−:PO43− ratios) may influence photosystem protein expression

    • Nutrient limitation combined with temperature stress could amplify the need for photoprotection

    • Different Synechococcus clades may show varied responses based on their nutrient adaptations

  • Evolutionary Implications:

    • Selection pressures may favor strains with more effective D1:1/D1:2 exchange mechanisms

    • Potential for adaptive evolution in the psbA genes encoding D1 variants

    • Changes in the global distribution of Synechococcus clades based on their photoprotection capacities

Future research should employ metagenomic approaches using databases like ProSynTaxDB to monitor changes in Synechococcus population structure and D1 variant abundance across oceanic regions experiencing different climate change impacts .

How can comparative studies across different cyanobacterial species enhance our understanding of photosystem evolution?

Comparative studies across cyanobacterial species offer powerful insights into photosystem evolution:

  • Evolutionary Conservation and Divergence:

    • Compare Photosystem Q(B) protein sequences across diverse cyanobacterial lineages

    • Identify conserved domains essential for function versus variable regions subject to selection

    • Track the evolution of D1 variants from ancestral to modern forms

  • Environmental Adaptation Mechanisms:

    • Contrast stress response strategies between coastal and open ocean Synechococcus strains

    • Compare D1:1/D1:2 exchange in Synechococcus with related mechanisms in other cyanobacteria

    • Analyze how different species balance photoprotection with photosynthetic efficiency

  • Structural-Functional Relationships:

    • Examine how structural variations in PSII components affect function across species

    • Compare the role of PsbQ across cyanobacteria, algae, and plants

    • Investigate how protein-protein interactions within PSII evolved over time

  • Taxonomic Classification Enhancement:

    • Use resources like ProSynTaxDB to improve classification of picocyanobacterial clades

    • Apply core protein similarity analysis to understand phylogenetic relationships

    • Correlate genetic differences with ecological niches and physiological traits

  • Evolutionary Model Development:

    • Build models of photosystem evolution from ancestral cyanobacteria to modern species

    • Reconstruct the evolutionary history of key adaptations like the D1:1/D1:2 exchange

    • Identify convergent evolution in photosynthetic mechanisms across diverse lineages

The remarkable conservation of the oxygen-evolving complex itself, despite variations in the extrinsic proteins across different phyla, highlights the fundamental importance of PSII function throughout evolutionary history . Understanding these evolutionary patterns can provide insights into the mechanisms that allowed cyanobacteria to thrive in diverse environments and ultimately transform Earth's atmosphere.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.